---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

DPM1/YPR183W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 900751 to 901554 CDS: 900751 - 901554 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
DPM1	YPR183W	SED3	ORF, Verified	S000006387
Description
Dolichol phosphate mannose (Dol-P-Man) synthase of the ER membrane, catalyzes the formation of Dol-P-Man from Dol-P and GDP-Man; required for glycosyl phosphatidylinositol membrane anchoring, O mannosylation, and protein glycosylation

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl-phosphate beta-D-mannosyltransferase activity Orlean P, et al. (1988) Cloning and sequencing of the yeast gene for dolichol phosphate mannose synthase, an essential protein. J Biol Chem 263(33):17499-507      IDA : Inferred from Direct Assay Assigned on 2002-09-26 SGD Lamani E, et al. (2006) Structural studies and mechanism of Saccharomyces cerevisiae dolichyl-phosphate-mannose synthase: insights into the initial step of synthesis of dolichyl-phosphate-linked oligosaccharide chains in membranes of endoplasmic reticulum. Glycobiology 16(7):666-78        IDA : Inferred from Direct Assay Assigned on 2007-05-03 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.83 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By GPI anchor biosynthetic process Orlean P (1992) Enzymes that recognize dolichols participate in three glycosylation pathways and are required for protein secretion. Biochem Cell Biol 70(6):438-47      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-26 SGD protein amino acid N-linked glycosylation Orlean P (1992) Enzymes that recognize dolichols participate in three glycosylation pathways and are required for protein secretion. Biochem Cell Biol 70(6):438-47      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-26 SGD protein amino acid O-linked glycosylation Orlean P (1992) Enzymes that recognize dolichols participate in three glycosylation pathways and are required for protein secretion. Biochem Cell Biol 70(6):438-47      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-26 SGD translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Preuss D, et al. (1991) Structure of the yeast endoplasmic reticulum: localization of ER proteins using immunofluorescence and immunoelectron microscopy. Yeast 7(9):891-911      IDA : Inferred from Direct Assay Assigned on 2002-09-26 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9908 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD nuclear envelope-endoplasmic reticulum network Russell SJ, et al. (1999) Subcellular localization, stoichiometry, and protein levels of 26 S proteasome subunits in yeast. J Biol Chem 274(31):21943-52        IDA : Inferred from Direct Assay Assigned on 2003-02-07 SGD

Pathways [TOP] [NEXT]
dolichyl phosphate D-mannose biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for DPM1/YPR183W for DPM1 DPM1 encodes the gene for dolichyl phosphate mannose (Dol-P-Man) synthase (EC 2.4.1.83) (1, 2) which adds a mannose moiety to dolichyl phosphate on the cytosolic side of the endoplasmic reticulum (ER); then the sugar moiety flips into the lumen of the ER, where Dol-P-Man serves as a source of mannose for three types of protein modifications: N-linked glycosylation, O-linked glycosylation, and synthesis of glycosyl phosphatidylinositol (GPI) anchors. A similar reaction is catalyzed by Alg5p, which adds glucose to Dol-P, but Alg5p participates only in N-linked glycosylation. Deletion of DPM1 is lethal (2), but conditional mutants accumulate lipid-linked oligosaccharides (LLO's) with five mannose residues (1) which are added to LLO's on the exterior of the ER by several proteins, including Alg1p, Alg2p, and Alg7p. Mutants lacking Dpm1p also fail to initiate O-mannosylation of proteins, and they accumulate unmannosylated phosphatidylinositol which is not incorporated into proteins (1). Similar phenotypes are also observed in mutants lacking Sec53p or Sec59p which catalyze reactions upstream of Dol-P-Man synthesis. Human Dpm1p also has Dol-P-Man synthase activity, but lacks lacks a C-terminal hydrophobic domain that allows localization to the ER membrane (3). Fully active ER-bound human Dol-P-Man synthase is a complex of three proteins: Dpm1p (OMIM), Dpm2p (OMIM), and Dpm3p (OMIM) (4, 5, 6). Mutations in DPM1 are associated with the congenital disorder of glycosylation CDG-Ie (OMIM). Last Updated: 2005-07-01

Basic References [TOP]

BASIC INFORMATION REFERENCES forDPM1/YPR183W for DPM1 1) Orlean P (1990) Dolichol phosphate mannose synthase is required in vivo for glycosyl phosphatidylinositol membrane anchoring, O mannosylation, and N glycosylation of protein in Saccharomyces cerevisiae. Mol Cell Biol 10(11):5796-805      2) Orlean P, et al. (1988) Cloning and sequencing of the yeast gene for dolichol phosphate mannose synthase, an essential protein. J Biol Chem 263(33):17499-507      3) Colussi PA, et al. (1997) Human and Saccharomyces cerevisiae dolichol phosphate mannose synthases represent two classes of the enzyme, but both function in Schizosaccharomyces pombe. Proc Natl Acad Sci U S A 94(15):7873-8        4) Maeda Y, et al. (1998) DPM2 regulates biosynthesis of dolichol phosphate-mannose in mammalian cells: correct subcellular localization and stabilization of DPM1, and binding of dolichol phosphate. EMBO J 17(17):4920-9        5) Tomita S, et al. (1998) A homologue of Saccharomyces cerevisiae Dpm1p is not sufficient for synthesis of dolichol-phosphate-mannose in mammalian cells. J Biol Chem 273(15):9249-54        6) Maeda Y, et al. (2000) Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. EMBO J 19(11):2475-82        7) Albright CF, et al. (1989) A 13-amino acid peptide in three yeast glycosyltransferases may be involved in dolichol recognition. Proc Natl Acad Sci U S A 86(19):7366-9      8) Haselbeck A (1989) Purification of GDP mannose:dolichyl-phosphate O-beta-D-mannosyltransferase from Saccharomyces cerevisiae. Eur J Biochem 181(3):663-8

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for DPM1/YPR183W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for DPM1/YPR183W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSIEYSV C-term QLYHLVF Length(aa) 267 MW(Da) 30,362 pI 7.97 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.308   Codon Adaptation Index 0.217   Frequency of Optimal Codons 0.584   Hydropathicity of Protein -0.030   Aromaticity Score 0.120	10 20 30 40 50 | | | | | MSIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGS VEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQH PPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARP LTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRV AIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITF WSILFFYVCYQLYHLVF*

Protein Structures from PDB: proteins of known structure with sequence similarity to DPM1/YPR183W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to DPM1 Homolog Source (per PDB) Protein Alignment: DPM1 vs. Homolog External Links P-Value %Identical %Similar Alignment 3bcv ( Chain: B, A) Crystal structure of a putative glycosyltransferase from bacteroides fragilis PDB_Info PDB_Structure Bacteroides fragilis NCTC 9343 Chain B = 0.009400 26 27 View alignment SCOP MMDB CATH Chain A = 0.009400 26 27 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
DPM1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPR183W	SGD Systematic Sequence
856313	NCBI: Gene ID
NP_015509.1	NCBI: RefSeq protein version ID
NP_015509.1	NCBI: RefSeq protein version ID
6325441	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
64 curated references; 0 references not yet curated
Cellular Location	Klemm RW, et al. (2009) Segregation of sphingolipids and sterols during formation of secretory vesicles at the trans-Golgi network. J Cell Biol 185(4):601-12	|FUS1 |GAP1 |GAS1 |MID2 |PEP12 |SEC6 |SUC2 |TLG1
Mutants/Phenotypes Strains/Constructs	Singh J and Tyers M (2009) A Rab escort protein integrates the secretion system with TOR signaling and ribosome biogenesis. Genes Dev 23(16):1944-58	|AKR1 |AVL9 |ERG5 |ERV29 |GAB1 |GPI16 |MRS6 |MSB4 |MSN5 |PKC1 |ROT1 |SEC17 |SEC20 |SEC23 |MORE
Mutants/Phenotypes RNA Levels and Processing Strains/Constructs	Torma A, et al. (2009) Concordant gene regulation related to perturbations of three GDP-mannose-related genes. FEMS Yeast Res 9(1):63-72	|DAL81 |DIG1 |FKH2 |GAT1 |INO2 |INO4 |ROX1 |RPH1 |SEC53 |SKN7 |STE12 |TEC1 |UME6 |VRG4 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Cellular Location	Chang J, et al. (2008) Purification of yeast membranes and organelles by sucrose density gradient centrifugation. Methods Mol Biol 457:141-9	|PEP1 |PMA1
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Non-Fungal Related Genes/Proteins	Grabinska KA, et al. (2008) Dolichyl-phosphate-glucose is used to make O-glycans on glycoproteins of Trichomonas vaginalis. Eukaryot Cell 7(8):1344-51	|ALG5
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Shams-Eldin H, et al. (2008) Plasmodium falciparum dolichol phosphate mannose synthase represents a novel clade. Biochem Biophys Res Commun 370(3):388-93
Cellular Location Other Features Strains/Constructs	Takeda Y and Nakano A (2008) In vitro Formation of a Novel Type of Membrane Vesicles Containing Dpm1p: Putative Transport Vesicles for Lipid Droplets in Budding Yeast. J Biochem 143(6):803-11	|ERG6
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Faulhammer F, et al. (2007) Growth control of Golgi phosphoinositides by reciprocal localization of sac1 lipid phosphatase and pik1 4-kinase. Traffic 8(11):1554-67	|FRQ1 |PIK1 |RER1 |SAC1 |SEC12 |SEC21 |SEC62
Other Features	Iiguni Y and Watarai H (2007) Electromagnetophoretic Force Measurement of a Single Binding Interaction between Lectin and Yeast Cell Surfaces. Anal Sci 23(1):121-6
Genetic Interactions Mutants/Phenotypes	Orlowski J, et al. (2007) Dissecting the role of dolichol in cell wall assembly in the yeast mutants impaired in early glycosylation reactions. Yeast 24(4):239-52	|GAS1 |RER2 |ROT1 |SEC59 |SLT2 |SRT1
RNA Levels and Processing	Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42	|AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Function/Process Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors	Lamani E, et al. (2006) Structural studies and mechanism of Saccharomyces cerevisiae dolichyl-phosphate-mannose synthase: insights into the initial step of synthesis of dolichyl-phosphate-linked oligosaccharide chains in membranes of endoplasmic reticulum. Glycobiology 16(7):666-78
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |OST1 |MORE
Cross-species Expression	Perlinska-Lenart U, et al. (2006) Glycoprotein Hypersecretion Alters the Cell Wall in Trichoderma reesei Strains Expressing the Saccharomyces cerevisiae Dolichylphosphate Mannose Synthase Gene. Appl Environ Microbiol 72(12):7778-84
Fungal Related Genes/Proteins	Perlinska-Lenart U, et al. (2006) Overexpression of the Saccharomyces cerevisiae RER2 gene in Trichoderma reesei affects dolichol dependent enzymes and protein glycosylation. Fungal Genet Biol 43(6):422-9	|PSA1 |RER2
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Cellular Location	Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50	|AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Strains/Constructs	Banerjee DK, et al. (2005) In vitro phosphorylation by cAMP-dependent protein kinase up-regulates recombinant Saccharomyces cerevisiae mannosylphosphodolichol synthase. J Biol Chem 280(6):4174-81
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52	|ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Regulatory Role Strains/Constructs	Faulhammer F, et al. (2005) Cell growth-dependent coordination of lipid signaling and glycosylation is mediated by interactions between Sac1p and Dpm1p. J Cell Biol 168(2):185-91	|SAC1
Genetic Interactions Transcription	Grabinska K, et al. (2005) Functional relationships between the Saccharomyces cerevisiae cis-prenyltransferases required for dolichol biosynthesis. Acta Biochim Pol 52(1):221-32	|ERG20 |RER2 |SRT1
Cellular Location	Inadome H, et al. (2005) Immunoisolaton of the yeast Golgi subcompartments and characterization of a novel membrane protein, Svp26, discovered in the Sed5-containing compartments. Mol Cell Biol 25(17):7696-710	|AKR1 |ANP1 |ARF1 |ATG27 |EHT1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV41 |ERV46 |GCS1 |MORE
Cross-species Expression Fungal Related Genes/Proteins	Perlinska-Lenart U, et al. (2005) Protein production and secretion in an Aspergillus nidulans mutant impaired in glycosylation. Acta Biochim Pol 52(1):195-206
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53	|ALG1 |ALG11 |ALG2 |ALG5 |ALG7 |STT3
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Janik A, et al. (2003) Overexpression of GDP-mannose pyrophosphorylase in Saccharomyces cerevisiae corrects defects in dolichol-linked saccharide formation and protein glycosylation. Biochim Biophys Acta 1621(1):22-30	|ALG1 |ALG2 |PSA1
Cross-species Expression Non-Fungal Related Genes/Proteins Strains/Constructs	Pu L, et al. (2003) A single point mutation resulting in an adversely reduced expression of DPM2 in the Lec15.1 cells. Biochem Biophys Res Commun 312(3):555-61
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Non-Fungal Related Genes/Proteins	Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22	|GAA1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI8 |SPT14
Function/Process Mutants/Phenotypes Strains/Constructs	Cullen PJ, et al. (2000) Defects in protein glycosylation cause SHO1-dependent activation of a STE12 signaling pathway in yeast. Genetics 155(3):1005-18	|ALG1 |FUS1 |HOG1 |KSS1 |MNN10 |OCH1 |PGI1 |PMI40 |PSA1 |RER2 |SHO1 |SPT14 |STE11 |STE12 |MORE
Function/Process Reviews	Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8	|GAA1 |GPI1 |GPI10 |GPI13 |GPI14 |GPI19 |GPI2 |GPI8 |LAS21 |MCD4 |SMP3 |SPT14
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Kruszewska JS, et al. (2000) Dolichol phosphate mannose synthase from the filamentous fungus Trichoderma reesei belongs to the human and Schizosaccharomyces pombe class of the enzyme. Glycobiology 10(10):983-91
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Maeda Y, et al. (2000) Human dolichol-phosphate-mannose synthase consists of three subunits, DPM1, DPM2 and DPM3. EMBO J 19(11):2475-82
Function/Process Genetic Interactions Techniques and Reagents	Kruszewska JS, et al. (1999) Overexpression of the Saccharomyces cerevisiae mannosylphosphodolichol synthase-encoding gene in Trichoderma reesei results in an increased level of protein secretion and abnormal cell ultrastructure. Appl Environ Microbiol 65(6):2382-7
Function/Process Mutants/Phenotypes Strains/Constructs	Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9	|ALG1 |ALG7 |GAA1 |GPI2 |PIS1 |SEC59 |SPT14 |WBP1
Cellular Location	Russell SJ, et al. (1999) Subcellular localization, stoichiometry, and protein levels of 26 S proteasome subunits in yeast. J Biol Chem 274(31):21943-52	|NAS2 |PRE1 |RPT4 |RPT6
Function/Process Mutants/Phenotypes Strains/Constructs	Kruszewska JS, et al. (1998) Isolation of a Trichoderma reesei cDNA encoding GTP: a-D-mannose-1-phosphate guanyltransferase involved in early steps of protein glycosylation. Curr Genet 33(6):445-50	|PSA1
Non-Fungal Related Genes/Proteins	Maeda Y, et al. (1998) DPM2 regulates biosynthesis of dolichol phosphate-mannose in mammalian cells: correct subcellular localization and stabilization of DPM1, and binding of dolichol phosphate. EMBO J 17(17):4920-9
Cross-species Expression Function/Process Non-Fungal Related Genes/Proteins	Tomita S, et al. (1998) A homologue of Saccharomyces cerevisiae Dpm1p is not sufficient for synthesis of dolichol-phosphate-mannose in mammalian cells. J Biol Chem 273(15):9249-54
Cross-species Expression Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Colussi PA, et al. (1997) Human and Saccharomyces cerevisiae dolichol phosphate mannose synthases represent two classes of the enzyme, but both function in Schizosaccharomyces pombe. Proc Natl Acad Sci U S A 94(15):7873-8
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Forsee WT, et al. (1997) Characterization of recombinant yeast dolichyl mannosyl phosphate synthase and site-directed mutagenesis of its cysteine residues. Eur J Biochem 244(3):953-8
Other Features	Doerrler WT, et al. (1996) Acylation of glucosaminyl phosphatidylinositol revisited. Palmitoyl-CoA dependent palmitoylation of the inositol residue of a synthetic dioctanoyl glucosaminyl phosphatidylinositol by hamster membranes permits efficient mannosylation of the glucosamine residue. J Biol Chem 271(43):27031-8
Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Mazhari-Tabrizi R, et al. (1996) Cloning and functional expression of glycosyltransferases from parasitic protozoans by heterologous complementation in yeast: the dolichol phosphate mannose synthase from Trypanosoma brucei brucei. Biochem J 316 ( Pt 3)():853-8
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zimmerman JW, et al. (1996) The isolation of a Dol-P-Man synthase from Ustilago maydis that functions in Saccharomyces cerevisiae. Yeast 12(8):765-71
Techniques and Reagents	Zou J and Krag SS (1995) Method identifying hybridizing regions of DNA within an insert. Biotechniques 18(3):402-4
Fungal Related Genes/Proteins	Heesen S, et al. (1994) Isolation of the ALG5 locus encoding the UDP-glucose:dolichyl-phosphate glucosyltransferase from Saccharomyces cerevisiae. Eur J Biochem 224(1):71-9	|ALG5 |PRC1
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG1 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Schutzbach JS, et al. (1993) The purification and characterization of recombinant yeast dolichyl-phosphate-mannose synthase. Site-directed mutagenesis of the putative dolichol recognition sequence. J Biol Chem 268(32):24190-6
Function/Process Strains/Constructs Techniques and Reagents	Wilson IB, et al. (1993) A novel mono-branched lipid phosphate acts as a substrate for dolichyl phosphate mannose synthetase. Biochem J 295 ( Pt 1)():195-201
Function/Process Mutants/Phenotypes Strains/Constructs	Costello LC and Orlean P (1992) Inositol acylation of a potential glycosyl phosphoinositol anchor precursor from yeast requires acyl coenzyme A. J Biol Chem 267(12):8599-603
Alias Genetic Interactions Techniques and Reagents	Hardwick KG, et al. (1992) Genes that allow yeast cells to grow in the absence of the HDEL receptor. EMBO J 11(11):4187-95	|ERD2 |KAR2 |SEC12 |SED1 |SED4
Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Techniques and Reagents	Orlean P (1992) Enzymes that recognize dolichols participate in three glycosylation pathways and are required for protein secretion. Biochem Cell Biol 70(6):438-47	|SEC59
Reviews	Conzelmann A, et al. (1991) Biosynthesis of glycophosphoinositol anchors in Saccharomyces cerevisiae. Cell Biol Int Rep 15(9):863-73	|ALG2 |ALG3 |GAS1 |KRE1 |MNN9 |SEC53
Cellular Location Protein Sequence Features Techniques and Reagents	Deglon N, et al. (1991) Translocation of the yeast dolichol-phosphate-mannose synthase into microsomal membranes. Biochem Biophys Res Commun 174(3):1337-42
Cellular Location Techniques and Reagents	Preuss D, et al. (1991) Structure of the yeast endoplasmic reticulum: localization of ER proteins using immunofluorescence and immunoelectron microscopy. Yeast 7(9):891-911
Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Beck PJ, et al. (1990) The Saccharomyces cerevisiae DPM1 gene encoding dolichol-phosphate-mannose synthase is able to complement a glycosylation-defective mammalian cell line. Mol Cell Biol 10(9):4612-22
Cross-species Expression Function/Process	DeGasperi R, et al. (1990) Correction of a defect in mammalian GPI anchor biosynthesis by a transfected yeast gene. Science 250(4983):988-91
Function/Process Mutants/Phenotypes Techniques and Reagents	Orlean P (1990) Dolichol phosphate mannose synthase is required in vivo for glycosyl phosphatidylinositol membrane anchoring, O mannosylation, and N glycosylation of protein in Saccharomyces cerevisiae. Mol Cell Biol 10(11):5796-805
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Albright CF, et al. (1989) A 13-amino acid peptide in three yeast glycosyltransferases may be involved in dolichol recognition. Proc Natl Acad Sci U S A 86(19):7366-9	|ALG1 |ALG7 |SEC59
Function/Process Protein Physical Properties Techniques and Reagents	Haselbeck A (1989) Purification of GDP mannose:dolichyl-phosphate O-beta-D-mannosyltransferase from Saccharomyces cerevisiae. Eur J Biochem 181(3):663-8
Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Orlean P, et al. (1988) Cloning and sequencing of the yeast gene for dolichol phosphate mannose synthase, an essential protein. J Biol Chem 263(33):17499-507

Return to SGD

Send a Message to the SGD Curators