KRE6/YPR159W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXVI: 857579 to 859741
CDS: 857579 - 859741
Genetic position: 95.9 cM
Genetic Map Data

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

KRE6 YPR159W CWH48 ORF, Verified S000006363

Description
Protein required for beta-1,6 glucan biosynthesis; putative beta-glucan synthase; appears functionally redundant with Skn1p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
glucosidase activity Montijn RC, et al. (1999) Localization of synthesis of beta1,6-glucan in Saccharomyces cerevisiae. J Bacteriol 181(24):7414-20
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2002-11-11 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
1,6-beta-glucan biosynthetic process Roemer T, et al. (1994) Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly. J Cell Biol 127(2):567-79
     ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-18 SGD
cellular cell wall organization GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0961
Assigned on 2008-02-14 UniProtKB
Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
fungal-type cell wall organization Roemer T, et al. (1994) Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly. J Cell Biol 127(2):567-79
     IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
Golgi cis cisterna Li H, et al. (2002) Actin patch assembly proteins Las17p and Sla1p restrict cell wall growth to daughter cells and interact with cis-Golgi protein Kre6p. Yeast 19(13):1097-112
       IDA : Inferred from Direct Assay
Assigned on 2003-01-23 SGD
integral to endoplasmic reticulum membrane Nakamata K, et al. (2007) KEG1/YFR042w Encodes a Novel Kre6-binding Endoplasmic Reticulum Membrane Protein Responsible for beta-1,6-Glucan Synthesis in Saccharomyces cerevisiae. J Biol Chem 282(47):34315-24
       IDA : Inferred from Direct Assay
Assigned on 2008-02-25 SGD
integral to membrane Roemer T, et al. (1994) Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly. J Cell Biol 127(2):567-79
     IDA : Inferred from Direct Assay
Assigned on 2002-07-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9906
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forKRE6/YPR159W for KRE6
1) Roemer T, et al. (1993) SKN1 and KRE6 define a pair of functional homologs encoding putative membrane proteins involved in beta-glucan synthesis. Mol Cell Biol 13(7):4039-48

2) Al-Aidroos K and Bussey H (1978) Chromosomal mutants of Saccharomyces cerevisiae affecting the cell wall binding site for killer factor. Can J Microbiol 24(3):228-37

3) Roemer T and Bussey H (1991) Yeast beta-glucan synthesis: KRE6 encodes a predicted type II membrane protein required for glucan synthesis in vivo and for glucan synthase activity in vitro. Proc Natl Acad Sci U S A 88(24):11295-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for KRE6/YPR159W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for KRE6/YPR159W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MPLRNLT

C-term SKFKLSS

Length(aa) 720

MW(Da) 80,122

pI 4.34

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.169

Codon Adaptation Index 0.189

Frequency of Optimal Codons 0.501

Hydropathicity of Protein -0.550

Aromaticity Score 0.122

10 20 30 40 50 | | | | | MPLRNLTETHNFSSTNLDTDGTGDDHDGAPLSSSPSFGQQNDNSTNDNAG LTNPFMGSDEESNARDGESLSSSVHYQPQGSDSSLLHDNSRLDLSQNKGV SDYKGYYSRNNSRAVSTANDNSFLQPPHRAIASSPSLNSNLSKNDILSPP EFDRYPLVGSRVTSMTQLNHHGRSPTSSPGNESSASFSSNPFLGEQDFSP FGGYPASSFPLMIDEKEEDDYLHNPDPEEEARLDRRRFIDDFKYMDKRSA SGLAGVLLLFLAAIFIFIVLPALTFTGAIDHESNTEEVTYLTQYQYPQLS AIRTSLVDPDTPDTAKTREAMDGSKWELVFSDEFNAEGRTFYDGDDPYWT APDVHYDATKDLEWYSPDASTTVNGTLQLRMDAFKNHGLYYRSGMLQSWN KVCFTQGALEISANLPNYGRVSGLWPGLWTMGNLGRPGYLASTQGVWPYS YESCDAGITPNQSSPDGISYLPGQKLSICTCDGEDHPNQGVGRGAPEIDV LEGETDTKIGVGIASQSLQIAPFDIWYMPDYDFIEVYNFTTTTMNTYAGG PFQQAVSAVSTLNVTWYEFGEYGGYFQKYAIEYLNDDDNGYIRWFVGDTP TYTIHAKALHPDGNIGWRRISKEPMSIILNLGISNNWAYIDWQYIFFPVV MSIDYVRIYQPSNAISVTCDPSDYPTYDYIQSHLNAFQNANLTTWEDAGY TFPKNILTGKCTSSKFKLSS*

Protein Structures from PDB: proteins of known structure with sequence similarity to KRE6/YPR159W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to KRE6 Homolog Source (per PDB) Protein Alignment: KRE6 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2vy0 ( Chain: A, B)
The x-ray structure of endo-beta-1,3-glucanase from pyrococcus furiosus
PDB_Info
PDB_Structure
Pyrococcus furiosus Chain A = 0.000139 32 28 View alignment SCOP
MMDB
CATH
Chain B = 0.000139 32 28 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
KRE6 Roemer T and Bussey H (1991) Yeast beta-glucan synthesis: KRE6 encodes a predicted type II membrane protein required for glucan synthesis in vivo and for glucan synthase activity in vitro. Proc Natl Acad Sci U S A 88(24):11295-9

Standard Name	Reference
KRE6	Roemer T and Bussey H (1991) Yeast beta-glucan synthesis: KRE6 encodes a predicted type II membrane protein required for glucan synthesis in vivo and for glucan synthase activity in vitro. Proc Natl Acad Sci U S A 88(24):11295-9

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YPR159W SGD Systematic Sequence

856287 NCBI: Gene ID

NP_015485.1 NCBI: RefSeq protein version ID

NP_015485.1 NCBI: RefSeq protein version ID

6325417 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YPR159W	SGD Systematic Sequence
856287	NCBI: Gene ID
NP_015485.1	NCBI: RefSeq protein version ID
NP_015485.1	NCBI: RefSeq protein version ID
6325417	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
48 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Aimanianda V, et al. (2009) Cell Wall {beta}-(1,6)-Glucan of Saccharomyces cerevisiae: STRUCTURAL CHARACTERIZATION AND IN SITU SYNTHESIS. J Biol Chem 284(20):13401-12
       |KRE5 |KRE9
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Substrates/Ligands/Cofactors
Kitamura A, et al. (2009) Discovery of a Small-Molecule Inhibitor of {beta}-1,6-Glucan Synthesis. Antimicrob Agents Chemother 53(2):670-677
       |SKN1
Large-scale phenotype analysis
Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
       |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Mutants/Phenotypes
Strains/Constructs
Teixeira MC, et al. (2009) Genome-wide identification of Saccharomyces cerevisiae genes required for maximal tolerance to ethanol. Appl Environ Microbiol 75(18):5761-72
       |AGP2 |ANP1 |ARC35 |BDP1 |BNA1 |CSL4 |CUP5 |CWC25 |ERG2 |ERG24 |FHL1 |FPS1 |GCN4 |GCR1 |MORE
DNA/RNA Sequence Features
Mapping
Other Features
Usher J and Bond U (2009) Recombination between homoeologous chromosomes of lager yeasts leads to loss of function of the hybrid GPH1 gene. Appl Environ Microbiol 75(13):4573-9
       |GPH1
Genetic Interactions
Mutants/Phenotypes
Gustavsson M, et al. (2008) Functional genomics of monensin sensitivity in yeast: implications for post-Golgi traffic and vacuolar H(+)-ATPase function. Mol Genet Genomics 280(3):233-48
       |AKR1 |APL2 |ARC18 |ARF1 |BRE5 |BTS1 |CCZ1 |CDC50 |CHC1 |COG8 |EAF1 |EOS1 |ERG28 |FAB1 |MORE
Mutants/Phenotypes
Loukin S, et al. (2008) A genome-wide survey suggests an osmoprotective role for vacuolar Ca2+ release in cell wall-compromised yeast. FASEB J 22(7):2405-15
       |ALG5 |ALG6 |ALG8 |BST1 |CSF1 |DIE2 |GAS1 |GDA1 |GUP1 |HHY1 |HUR1 |KRE1 |LAS21 |MAK10 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Cellular Location
Protein Processing/Modification/Regulation
Protein-protein Interactions
Regulation of
Strains/Constructs
Takeuchi M, et al. (2008) Saccharomyces cerevisiae Rot1 Is an Essential Molecular Chaperone in the Endoplasmic Reticulum. Mol Biol Cell 19(8):3514-25
       |DRS2 |GUP1 |KAR2 |KRE5 |ROT1 |UBC7
Evolution
Fungal Related Genes/Proteins
Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77
       |ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
Cellular Location
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Nakamata K, et al. (2007) KEG1/YFR042w Encodes a Novel Kre6-binding Endoplasmic Reticulum Membrane Protein Responsible for beta-1,6-Glucan Synthesis in Saccharomyces cerevisiae. J Biol Chem 282(47):34315-24
       |KEG1
Cellular Location
Sarry JE, et al. (2007) Analysis of the vacuolar luminal proteome of Saccharomyces cerevisiae. FEBS J 274(16):4287-305
       |AAT2 |ACH1 |ACO1 |ACS2 |ACT1 |ADE13 |ADH1 |ADH2 |ADO1 |AEP3 |ALD6 |AMS1 |ANB1 |APE3 |MORE
Mutants/Phenotypes
Techniques and Reagents
Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
       |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Reviews
Klis FM, et al. (2006) Cell wall construction in Saccharomyces cerevisiae. Yeast 23(3):185-202
       |AGA1 |BGL2 |CHS1 |CHS2 |CHS3 |CIS3 |CLB2 |CLN2 |CRH1 |CTS1 |CWP1 |CWP2 |DAN1 |DAN4 |MORE
Reviews
Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43
       |ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Imazu H and Sakurai H (2005) Saccharomyces cerevisiae heat shock transcription factor regulates cell wall remodeling in response to heat shock. Eukaryot Cell 4(6):1050-6
       |ECL1 |EXG1 |GIS1 |HSF1 |MID2 |MSN2 |MSN4 |PDE2 |PKC1 |RIM15 |ROM2 |RTS1 |SLG1 |WSC2 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Bowen S and Wheals AE (2004) Incorporation of Sed1p into the cell wall of Saccharomyces cerevisiae involves KRE6. FEMS Yeast Res 4(7):731-5
       |SED1
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Lagorce A, et al. (2003) Genome-wide analysis of the response to cell wall mutations in the yeast Saccharomyces cerevisiae. J Biol Chem 278(22):20345-57
           |CRZ1 |FKS1 |GAS1 |HSF1 |MNN9 |MSN2 |MSN4 |PKC1 |RLM1 |SLT2 |SMI1 |SWI4
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tomishige N, et al. (2003) Mutations that are synthetically lethal with a gas1Delta allele cause defects in the cell wall of Saccharomyces cerevisiae. Mol Genet Genomics 269(4):562-73
     |BIG1 |CSG2 |GAS1 |IPT1 |KEX2 |MKC7 |SLG1 |YPS1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Levinson JN, et al. (2002) Functional, comparative and cell biological analysis of Saccharomyces cerevisiae Kre5p. Yeast 19(14):1243-59
       |KRE5
Cellular Location
Function/Process
Protein Sequence Features
Protein-protein Interactions
Li H, et al. (2002) Actin patch assembly proteins Las17p and Sla1p restrict cell wall growth to daughter cells and interact with cis-Golgi protein Kre6p. Yeast 19(13):1097-112
       |LAS17 |OCH1 |SLA1 |VRP1
Protein-protein Interactions
Allen MJ, et al. (2001) Interactions of surfactant proteins A and D with Saccharomyces cerevisiae and Aspergillus fumigatus. Infect Immun 69(4):2037-44

Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Breton AM, et al. (2001) The yeast Rvs161 and Rvs167 proteins are involved in secretory vesicles targeting the plasma membrane and in cell integrity. Yeast 18(11):1053-68
     |RVS167 |SLT2
Evolution
Friedman R and Hughes AL (2001) Gene duplication and the structure of eukaryotic genomes. Genome Res 11(3):373-81
       |AAD10 |AAD16 |AAD4 |ARF1 |ARF2 |ASK10 |ASN1 |ASN2 |CLA4 |CLB1 |CLB2 |CLB5 |CLB6 |COS1 |MORE
Regulation of
Transcription
Hellauer K, et al. (2001) Decreased expression of specific genes in yeast cells lacking histone H1. J Biol Chem 276(17):13587-92
       |ACO1 |AIP1 |ALD4 |APE3 |ATP1 |EFT1 |EFT2 |FAR1 |FUM1 |GAD1 |GCV2 |GLC3 |GLT1 |GNP1 |MORE
Cell Cycle Phase Involved
RNA Levels and Processing
Regulation of
Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708
               |ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD4 |BUD8 |BUD9 |CDC20 |CDC21 |CDC45 |CDC6 |MORE
Fungal Related Genes/Proteins
Kapteyn JC, et al. (2000) The cell wall architecture of Candida albicans wild-type cells and cell wall-defective mutants. Mol Microbiol 35(3):601-11
       |HSP150
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Sasaki T, et al. (2000) Extragenic suppressors that rescue defects in the heat stress response of the budding yeast mutant tom1. Mol Gen Genet 262(6):940-8
     |BCY1 |CYR1 |MOT1 |MSN2 |PDE2 |SCH9 |SSE1 |TMR4 |TMR7 |TOM1 |ZUO1
Transcription
Chang M, et al. (1999) A complex containing RNA polymerase II, Paf1p, Cdc73p, Hpr1p, and Ccr4p plays a role in protein kinase C signaling. Mol Cell Biol 19(2):1056-67
       |CCR4 |CDC73 |CYC1 |DSE4 |FKS1 |GAL11 |GAS1 |HPR1 |MNN1 |PAF1 |PFK26 |PKC1 |PRS1 |SIN4 |MORE
Function/Process
Fungal Related Genes/Proteins
Montijn RC, et al. (1999) Localization of synthesis of beta1,6-glucan in Saccharomyces cerevisiae. J Bacteriol 181(24):7414-20
       |KRE5 |SEC1 |SKN1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Abeijon C and Chen LY (1998) The role of glucosidase I (Cwh41p) in the biosynthesis of cell wall beta-1,6-glucan is indirect. Mol Biol Cell 9(10):2729-38
       |ALG5 |CWH41 |KRE1
Mutants/Phenotypes
Lussier M, et al. (1997) Large scale identification of genes involved in cell surface biosynthesis and architecture in Saccharomyces cerevisiae. Genetics 147(2):435-50
     |ACS1 |ALG12 |ALG9 |ARG7 |ATG32 |BUD8 |COX11 |CWP2 |DCG1 |DFG16 |DIT2 |ECM10 |ECM11 |ECM12 |MORE
Fungal Related Genes/Proteins
Mio T, et al. (1997) Isolation of the Candida albicans homologs of Saccharomyces cerevisiae KRE6 and SKN1: expression and physiological function. J Bacteriol 179(7):2363-72
       |SKN1
Mutants/Phenotypes
Strains/Constructs
Narasimhan S, et al. (1997) Prohibitin, a putative negative control element present in Pneumocystis carinii. Infect Immun 65(12):5125-30
       |PHB1 |PHB2
Genetic Interactions
Popolo L, et al. (1997) Increase in chitin as an essential response to defects in assembly of cell wall polymers in the ggp1delta mutant of Saccharomyces cerevisiae. J Bacteriol 179(2):463-9
       |CHS3 |GAS1 |KRE1
Genetic Interactions
Jiang B, et al. (1996) CWH41 encodes a novel endoplasmic reticulum membrane N-glycoprotein involved in beta 1,6-glucan assembly. J Bacteriol 178(4):1162-71
       |CWH41 |CWP1 |KRE1
Reviews
Cid VJ, et al. (1995) Molecular basis of cell integrity and morphogenesis in Saccharomyces cerevisiae. Microbiol Rev 59(3):345-86
     |ACT1 |BCK1 |BGL2 |CDC42 |CHS1 |CHS2 |CHS3 |CHS5 |CHS6 |EXG1 |PPH21 |PPH22 |PPZ1 |PTC1 |MORE
Mutants/Phenotypes
Kasahara S, et al. (1994) Involvement of cell wall beta-glucan in the action of HM-1 killer toxin. FEBS Lett 348(1):27-32

Alias
Mutants/Phenotypes
Strains/Constructs
Ram AF, et al. (1994) A new approach for isolating cell wall mutants in Saccharomyces cerevisiae by screening for hypersensitivity to calcofluor white. Yeast 10(8):1019-30
     |CAX4 |CWH41 |CWH43 |FKS1 |GAS1 |PTC1 |SPT14 |VMA9 |YCL007C
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Roemer T, et al. (1994) Characterization of the yeast (1-->6)-beta-glucan biosynthetic components, Kre6p and Skn1p, and genetic interactions between the PKC1 pathway and extracellular matrix assembly. J Cell Biol 127(2):567-79
     |KRE9 |PKC1 |SKN1
DNA/RNA Sequence Features
Mapping
Strains/Constructs
Roemer T, et al. (1994) DNA sequence analysis of a 10.4 kbp region on the right arm of yeast chromosome XVI positions GPH1 and SGV1 adjacent to KRE6, and identifies two novel tRNA genes. Yeast 10(11):1527-30
     |GPH1 |SGV1
Fungal Related Genes/Proteins
Genetic Interactions
Brown JL and Bussey H (1993) The yeast KRE9 gene encodes an O glycoprotein involved in cell surface beta-glucan assembly. Mol Cell Biol 13(10):6346-56
     |KRE1 |KRE11 |KRE5 |KRE9 |SKN1
Genetic Interactions
Brown JL, et al. (1993) A mutational analysis of killer toxin resistance in Saccharomyces cerevisiae identifies new genes involved in cell wall (1-->6)-beta-glucan synthesis. Genetics 133(4):837-49
     |ADE3 |KRE1 |KRE10 |KRE11 |KRE9
Genetic Interactions
Roemer T, et al. (1993) SKN1 and KRE6 define a pair of functional homologs encoding putative membrane proteins involved in beta-glucan synthesis. Mol Cell Biol 13(7):4039-48
     |ADE3 |SKN1
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Roemer T and Bussey H (1991) Yeast beta-glucan synthesis: KRE6 encodes a predicted type II membrane protein required for glucan synthesis in vivo and for glucan synthase activity in vitro. Proc Natl Acad Sci U S A 88(24):11295-9

Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Boone C, et al. (1990) Yeast KRE genes provide evidence for a pathway of cell wall beta-glucan assembly. J Cell Biol 110(5):1833-43
     |KRE1 |KRE5
Fungal Related Genes/Proteins
Genetic Interactions
Meaden P, et al. (1990) The yeast KRE5 gene encodes a probable endoplasmic reticulum protein required for (1----6)-beta-D-glucan synthesis and normal cell growth. Mol Cell Biol 10(6):3013-9
     |KRE5

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.