---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AXL1/YPR122W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 782041 to 785667 CDS: 782041 - 785667 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AXL1	YPR122W	FUS5, STE22	ORF, Verified	S000006326
Description
Haploid specific endoprotease that performs one of two N-terminal cleavages during maturation of a-factor mating pheromone; required for axial budding pattern of haploid cells

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR011237 , EBI:IPR011249 Assigned on 2008-02-13 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB metal ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR011237 , EBI:IPR011249 Assigned on 2008-02-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0479 Assigned on 2007-05-23 UniProtKB metalloendopeptidase activity Adames N, et al. (1995) Role of yeast insulin-degrading enzyme homologs in propheromone processing and bud site selection. Science 270(5235):464-7      IMP : Inferred from Mutant Phenotype ISS : Inferred from Sequence or structural Similarity Assigned on 2002-12-02 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001431 , EBI:IPR007863 , EBI:IPR011765 Assigned on 2007-05-23 UniProtKB metallopeptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0482 Assigned on 2007-05-23 UniProtKB peptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0645 Assigned on 2007-05-23 UniProtKB zinc ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007863 Assigned on 2009-11-20 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0862 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By axial cellular bud site selection Fujita A, et al. (1994) A yeast gene necessary for bud-site selection encodes a protein similar to insulin-degrading enzymes. Nature 372(6506):567-70      IMP : Inferred from Mutant Phenotype Assigned on 2009-06-24 SGD cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cofactor transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT conjugation with cellular fusion Elia L and Marsh L (1998) A role for a protease in morphogenic responses during yeast cell fusion. J Cell Biol 142(6):1473-85        NAS : Non-traceable Author Statement Assigned on 2002-06-14 SGD Dorer R, et al. (1997) Genetic analysis of default mating behavior in Saccharomyces cerevisiae. Genetics 146(1):39-55      NAS : Non-traceable Author Statement Assigned on 2002-06-14 SGD peptide pheromone maturation Adames N, et al. (1995) Role of yeast insulin-degrading enzyme homologs in propheromone processing and bud site selection. Science 270(5235):464-7      IGI : Inferred from Genetic Interaction with SGD:STE23 ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype Assigned on 2009-06-24 SGD proteolysis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001431 , EBI:IPR007863 , EBI:IPR011765 Assigned on 2007-05-23 UniProtKB reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52            IDA : Inferred from Direct Assay Assigned on 2003-01-09 SGD GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0029 Assigned on 2009-03-04 UniProtKB integral to membrane Boyartchuk VL and Rine J (1998) Roles of prenyl protein proteases in maturation of Saccharomyces cerevisiae a-factor. Genetics 150(1):95-101        TAS : Traceable Author Statement Assigned on 2002-10-07 SGD mating projection tip Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52            IDA : Inferred from Direct Assay Assigned on 2003-01-09 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forAXL1/YPR122W for AXL1 1) Chen P, et al. (1997) Biogenesis of the Saccharomyces cerevisiae mating pheromone a-factor. J Cell Biol 136(2):251-69        2) Fujita A, et al. (1994) A yeast gene necessary for bud-site selection encodes a protein similar to insulin-degrading enzymes. Nature 372(6506):567-70      3) Adames N, et al. (1995) Role of yeast insulin-degrading enzyme homologs in propheromone processing and bud site selection. Science 270(5235):464-7      4) Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AXL1/YPR122W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AXL1/YPR122W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSLREVT C-term FFRKAAF Length(aa) 1,208 MW(Da) 138,330 pI 8.44 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.069   Codon Adaptation Index 0.104   Frequency of Optimal Codons 0.373   Hydropathicity of Protein -0.249   Aromaticity Score 0.114

10 20 30 40 50 | | | | | MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSL TVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQN AFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEI YAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKSA VKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYKNT MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCEL FGDESPGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENI KRITTIVLNRLLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEE CSKLSGILQDDLECLTPPNIFKGFKSLIEIDDPNIEKYENTKANIQWWTG QAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSDICTDFFYEFE YYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSF EVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKG NVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRN KYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALELTELESFEKFCFL FWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKPTIRLYPP PSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRI NEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLL NEIVANVQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQ KLTLKKYLAFFESKISIYSAQRSKLSIMITSPMAEKEIASRKMFLQLEAF LKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNEVFKLGTVVLQ EILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP NFFRKAAF*

Protein Structures from PDB: proteins of known structure with sequence similarity to AXL1/YPR122W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to AXL1 Homolog Source (per PDB) Protein Alignment: AXL1 vs. Homolog External Links P-Value %Identical %Similar Alignment 2jbu ( Chain: B, A) Crystal structure of human insulin degrading enzyme complexed with co-purified peptides. PDB_Info PDB_Structure Homo sapiens | Escherichia coli Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2g48 ( Chain: B, A) Crystal structure of human insulin-degrading enzyme in complex with amylin PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2jg4 ( Chain: B, A) Substrate-free ide structure in its closed conformation PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 3e50 ( Chain: B, A) Insulin-degrading enzym PDB_Info PDB_Structure Unknown Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2g56 ( Chain: B, A) Crystal structure of human insulin-degrading enzyme in complex with insulin b chain PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2g54 ( Chain: B, A) Crystal structure of zn-bound human insulin-degrading enzyme in complex with insulin b chain PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2g47 ( Chain: B, A) Crystal structure of human insulin-degrading enzyme in complex with amyloid-beta (1-40) PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2g49 ( Chain: B, A) Crystal structure of human insulin-degrading enzyme in complex with glucagon PDB_Info PDB_Structure Homo sapiens Chain B = 3.4e-42 22 31 View alignment SCOP MMDB CATH Chain A = 3.4e-42 22 31 View alignment 2wc0 ( Chain: B, A) Crystal structure of human insulin degrading enzyme in complex with iodinated insulin PDB_Info PDB_Structure Homo sapiens Chain B = 9.3e-42 23 30 View alignment SCOP MMDB CATH Chain A = 9.3e-42 23 30 View alignment 2wby ( Chain: A, B) Crystal structure of human insulin-degrading enzyme in complex with insulin PDB_Info PDB_Structure Homo sapiens Chain A = 9.3e-42 23 30 View alignment SCOP MMDB CATH Chain B = 9.3e-42 23 30 View alignment 3e4a ( Chain: B, A) Insulin-degrading enzy PDB_Info PDB_Structure Unknown Chain B = 9.8e-42 23 30 View alignment SCOP MMDB CATH Chain A = 9.8e-42 23 30 View alignment 3e4z ( Chain: A, B) Insulin-degrading enzym PDB_Info PDB_Structure Unknown Chain A = 1.4e-41 22 31 View alignment SCOP MMDB CATH Chain B = 1.4e-41 22 31 View alignment 3cww ( Chain: A, B) Crystal structure of ide-bradykinin complex PDB_Info PDB_Structure Homo sapiens Chain A = 4.7e-41 22 31 View alignment SCOP MMDB CATH Chain B = 4.7e-41 22 31 View alignment 1q2l ( Chain: A) Crystal structure of pitrilysin PDB_Info PDB_Structure Escherichia coli str. k12 substr. w3110 2.6e-17 26 29 View alignment SCOP MMDB CATH 1hr6 ( Chain: F, H, D, B) Yeast mitochondrial processing peptidase PDB_Info PDB_Structure Saccharomyces cerevisiae Chain F = 1.5e-06 24 34 View alignment SCOP MMDB CATH Chain H = 1.5e-06 24 34 View alignment Chain D = 1.5e-06 24 34 View alignment Chain B = 1.5e-06 24 34 View alignment 1hr8 ( Chain: B, H, D, F) Yeast mitochondrial processing peptidase beta-e73q mutant complexed with cytochrome c oxidase iv signal peptide PDB_Info PDB_Structure Saccharomyces cerevisiae Chain B = 2.7e-06 24 34 View alignment SCOP MMDB CATH Chain H = 2.7e-06 24 34 View alignment Chain D = 2.7e-06 24 34 View alignment Chain F = 2.7e-06 24 34 View alignment 1hr9 ( Chain: H, F, D, B) Yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide PDB_Info PDB_Structure Saccharomyces cerevisiae Chain H = 2.7e-06 24 34 View alignment SCOP MMDB CATH Chain F = 2.7e-06 24 34 View alignment Chain D = 2.7e-06 24 34 View alignment Chain B = 2.7e-06 24 34 View alignment 1hr7 ( Chain: H, D, F, B) Yeast mitochondrial processing peptidase beta-e73q mutant PDB_Info PDB_Structure Saccharomyces cerevisiae Chain H = 2.7e-06 24 34 View alignment SCOP MMDB CATH Chain D = 2.7e-06 24 34 View alignment Chain F = 2.7e-06 24 34 View alignment Chain B = 2.7e-06 24 34 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
AXL1	Fujita A, et al. (1994) A yeast gene necessary for bud-site selection encodes a protein similar to insulin-degrading enzymes. Nature 372(6506):567-70

Alias Name(s)	Reference
FUS5	Kurihara LJ, et al. (1994) Nuclear congression and membrane fusion: two distinct events in the yeast karyogamy pathway. J Cell Biol 126(4):911-23
STE22	Adames N, et al. (1995) Role of yeast insulin-degrading enzyme homologs in propheromone processing and bud site selection. Science 270(5235):464-7

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPR122W	SGD Systematic Sequence
856240	NCBI: Gene ID
NP_015447.1	NCBI: RefSeq protein version ID
NP_015447.1	NCBI: RefSeq protein version ID
6325379	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
34 curated references; 0 references not yet curated
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Alper BJ, et al. (2009) Yeast Ste23p shares functional similarities with mammalian insulin-degrading enzymes. Yeast 26(11):595-610	|STE23
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Krishnankutty RK, et al. (2009) Proteolytic processing of certain CaaX motifs can occur in the absence of the Rce1p and Ste24p CaaX proteases. Yeast 26(8):451-63	|MFA1 |MOH1 |MRPS8 |NAP1 |PEX19 |POP8 |RCE1 |REC1 |SAM37 |STE14 |STE23 |STE24 |VPS71 |VTI1 |MORE
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Reviews	Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384	|AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |RAX1 |MORE
Cellular Location	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |CDC10 |MORE
Protein Physical Properties	de Godoy LM, et al. (2008) Comprehensive mass-spectrometry-based proteome quantification of haploid versus diploid yeast. Nature 455(7217):1251-4	|ACT1 |AFR1 |ASG7 |BAR1 |BEM1 |BNI1 |CDC24 |CDC28 |CDC42 |CLN1 |CLN2 |CLN3 |CTS1 |DIG1 |MORE
Reviews	Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96	|ACT1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC10 |CDC11 |MORE
Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Alper BJ, et al. (2006) A common genetic system for functional studies of pitrilysin and related M16A proteases. Biochem J 398(1):145-52	|STE23
Mutants/Phenotypes Strains/Constructs	Huyer G, et al. (2006) Saccharomyces cerevisiae a-factor mutants reveal residues critical for processing, activity, and export. Eukaryot Cell 5(9):1560-70	|MFA1 |MFA2 |RAM1 |RCE1 |STE14 |STE24 |STE3 |STE6
Fungal Related Genes/Proteins	Fabre E, et al. (2005) Comparative genomics in hemiascomycete yeasts: evolution of sex, silencing, and subtelomeres. Mol Biol Evol 22(4):856-73	|ABF1 |ASH1 |CDC24 |DOT1 |ESA1 |ESC1 |FAR1 |FUS3 |GCN5 |HMLALPHA1 |HMLALPHA2 |HMRA1 |HMRA2 |HO |MORE
Cellular Location Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Strains/Constructs	Kim S, et al. (2005) Yeast as a tractable genetic system for functional studies of the insulin-degrading enzyme. J Biol Chem 280(30):27481-90	|MFA1 |MFA2 |STE23
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9	|AXL2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |RAX1
DNA/RNA Sequence Features RNA Levels and Processing Regulation of Transcription	Galgoczy DJ, et al. (2004) Genomic dissection of the cell-type-specification circuit in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 101(52):18069-74	|AGA2 |AMN1 |BAR1 |CCW12 |DDR2 |FAR1 |FUS3 |GPA1 |HO |HOG1 |ICS2 |MATA1 |MATALPHA1 |MATALPHA2 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Jonson L, et al. (2004) Enhanced peptide secretion by gene disruption of CYM1, a novel protease in Saccharomyces cerevisiae. Eur J Biochem 271(23-24):4788-97	|AAP1 |AFG3 |APE2 |APE3 |CYM1 |ECM14 |KAE1 |LAP2 |LAP4 |OCT1 |PRD1 |QRI7 |STE23 |STE24 |MORE
Cellular Location Function/Process RNA Levels and Processing	Cullen PJ and Sprague GF Jr (2002) The roles of bud-site-selection proteins during haploid invasive growth in yeast. Mol Biol Cell 13(9):2990-3004	|AXL2 |BUD2 |BUD3 |BUD4 |BUD8 |SNF1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulation of Regulatory Role Strains/Constructs	Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52	|AXL2 |BUD3 |BUD4 |BUD5
Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Palecek SP, et al. (2000) Genetic analysis reveals that FLO11 upregulation and cell polarization independently regulate invasive growth in Saccharomyces cerevisiae. Genetics 156(3):1005-23	|ADH1 |ARO7 |AXL2 |BEM2 |BPL1 |BUD3 |BUD4 |CDC53 |CSE2 |DIA1 |DIA2 |DIA3 |DIA4 |ELM1 |MORE
Other Features Reviews	Sinensky M (2000) Recent advances in the study of prenylated proteins. Biochim Biophys Acta 1484(2-3):93-106	|RAS2 |RCE1 |STE14 |STE24
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Giot L, et al. (1999) Combining mutations in the incoming and outgoing pheromone signal pathways causes a synergistic mating defect in Saccharomyces cerevisiae. Yeast 15(9):765-80	|AFR1 |BAR1 |FUS3 |MFA1 |MFA2 |SST2 |STE2 |STE6
Function/Process Protein Processing/Modification/Regulation RNA Levels and Processing	Meacham GC, et al. (1999) Mutations in the yeast Hsp40 chaperone protein Ydj1 cause defects in Axl1 biogenesis and pro-a-factor processing. J Biol Chem 274(48):34396-402	|YDJ1
Cellular Location Function/Process Substrates/Ligands/Cofactors	Boyartchuk VL and Rine J (1998) Roles of prenyl protein proteases in maturation of Saccharomyces cerevisiae a-factor. Genetics 150(1):95-101	|MFA1 |RCE1 |STE23 |STE24
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Elia L and Marsh L (1998) A role for a protease in morphogenic responses during yeast cell fusion. J Cell Biol 142(6):1473-85	|BEM1 |BUD3 |CDC24 |CDC42 |FUS2 |RSR1
Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Tam A, et al. (1998) Dual roles for Ste24p in yeast a-factor maturation: NH2-terminal proteolysis and COOH-terminal CAAX processing. J Cell Biol 142(3):635-49	|MFA1 |MFA2 |RCE1 |STE24
Mutants/Phenotypes	Chen P, et al. (1997) A novel a-factor-related peptide of Saccharomyces cerevisiae that exits the cell by a Ste6p-independent mechanism. Mol Biol Cell 8(7):1273-91	|MFA1 |MFA2 |STE24 |STE6
Substrates/Ligands/Cofactors	Chen P, et al. (1997) Biogenesis of the Saccharomyces cerevisiae mating pheromone a-factor. J Cell Biol 136(2):251-69	|MFA1 |MFA2 |RAM1 |RAM2 |STE14 |STE24 |STE6
Mutants/Phenotypes Strains/Constructs	Dorer R, et al. (1997) Genetic analysis of default mating behavior in Saccharomyces cerevisiae. Genetics 146(1):39-55	|BNI1 |CHS5 |FUS1 |FUS2 |FUS3 |MFA2 |PEA2 |RVS161 |SHE2 |SHE3 |SHE4 |SPA2
Reviews	Marsh L and Rose MD (1997) "The pathway of cell and nuclear fusion during mating in S. cerevisiae" Pp. 827-888 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|FUS1 |RAM1 |SPA2
Reviews	Yang S, et al. (1997) A role for the actin cytoskeleton of Saccharomyces cerevisiae in bipolar bud-site selection. J Cell Biol 136(1):111-23	|ABP1 |ACT1 |AXL2 |BUD4 |BUD8 |BUD9 |MAD2 |SAC6 |SLA1 |SLA2 |SPA2 |SRV2
Alias Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Brizzio V, et al. (1996) Cell fusion during yeast mating requires high levels of a-factor mating pheromone. J Cell Biol 135(6 Pt 2):1727-39	|MFA1 |RAM1 |SST2
Reviews	Chant J (1996) Septin scaffolds and cleavage planes in Saccharomyces. Cell 84(2):187-90	|CDC10 |CDC11 |CDC12 |CDC3
Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Adames N, et al. (1995) Role of yeast insulin-degrading enzyme homologs in propheromone processing and bud site selection. Science 270(5235):464-7	|MFA1 |STE23
Reviews	Caldwell GA, et al. (1995) Fungal lipopeptide mating pheromones: a model system for the study of protein prenylation. Microbiol Rev 59(3):406-22	|CDC43 |MDL1 |MDL2 |MF(ALPHA)1 |MF(ALPHA)2 |RAM1 |RAM2 |RHO1 |STE14 |STE18 |STE2 |STE3 |STE6
Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Regulation of	Fujita A, et al. (1994) A yeast gene necessary for bud-site selection encodes a protein similar to insulin-degrading enzymes. Nature 372(6506):567-70	|BUD4 |BUD5
Alias Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Kurihara LJ, et al. (1994) Nuclear congression and membrane fusion: two distinct events in the yeast karyogamy pathway. J Cell Biol 126(4):911-23	|JEM1 |KAR3 |KAR4 |KAR5 |KAR9 |RAM1 |RVS161 |SPA2

Return to SGD

Send a Message to the SGD Curators