---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

PIS1/YPR113W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 752255 to 752917 CDS: 752255 - 752917 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
PIS1	YPR113W		ORF, Verified	S000006317
Description
Phosphatidylinositol synthase, required for biosynthesis of phosphatidylinositol, which is a precursor for polyphosphoinositides, sphingolipids, and glycolipid anchors for some of the plasma membrane proteins

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity Nikawa J and Yamashita S (1984) Molecular cloning of the gene encoding CDPdiacylglycerol-inositol 3-phosphatidyl transferase in Saccharomyces cerevisiae. Eur J Biochem 143(2):251-6      IMP : Inferred from Mutant Phenotype Assigned on 2005-03-11 SGD Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.7.8.11 Assigned on 2007-05-23 UniProtKB phosphotransferase activity, for other substituted phosphate groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle Nikawa J, et al. (1987) Primary structure and disruption of the phosphatidylinositol synthase gene of Saccharomyces cerevisiae. J Biol Chem 262(10):4876-81      IMP : Inferred from Mutant Phenotype Assigned on 2005-03-11 SGD phosphatidylinositol biosynthetic process Nikawa J and Yamashita S (1984) Molecular cloning of the gene encoding CDPdiacylglycerol-inositol 3-phosphatidyl transferase in Saccharomyces cerevisiae. Eur J Biochem 143(2):251-6      IMP : Inferred from Mutant Phenotype Assigned on 2005-03-11 SGD Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD phospholipid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0594 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000462 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB microsome Kuchler K, et al. (1986) Subcellular and submitochondrial localization of phospholipid-synthesizing enzymes in Saccharomyces cerevisiae. J Bacteriol 165(3):901-10      IDA : Inferred from Direct Assay Assigned on 2005-03-11 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0492 Assigned on 2009-06-29 UniProtKB mitochondrial outer membrane Kuchler K, et al. (1986) Subcellular and submitochondrial localization of phospholipid-synthesizing enzymes in Saccharomyces cerevisiae. J Bacteriol 165(3):901-10      IDA : Inferred from Direct Assay Assigned on 2005-03-11 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1000 Assigned on 2008-10-02 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0172 Assigned on 2008-02-13 UniProtKB mitochondrion Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
phosphatidylinositol biosynthesis superpathway of phospholipid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forPIS1/YPR113W for PIS1 1) Nikawa J, et al. (1987) Primary structure and disruption of the phosphatidylinositol synthase gene of Saccharomyces cerevisiae. J Biol Chem 262(10):4876-81      2) Nikawa J and Yamashita S (1997) Phosphatidylinositol synthase from yeast. Biochim Biophys Acta 1348(1-2):173-8      3) Nikawa J and Yamashita S (1984) Molecular cloning of the gene encoding CDPdiacylglycerol-inositol 3-phosphatidyl transferase in Saccharomyces cerevisiae. Eur J Biochem 143(2):251-6

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PIS1/YPR113W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PIS1/YPR113W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSSNSTP C-term NEKNKTY Length(aa) 220 MW(Da) 24,823 pI 8.92 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.178   Codon Adaptation Index 0.170   Frequency of Optimal Codons 0.505   Hydropathicity of Protein 0.100   Aromaticity Score 0.136	10 20 30 40 50 | | | | | MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYS TSCLLDALDGTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWC VFFQLMLGLDITSHYMHMYASLSAGKTSHKSVGEGESRLLHLYYTRRDVL FTICAFNELFYAGLYLQLFSNSATFGKWTTIISFPGYVFKQTANVVQLKR AALILADNDAKNANEKNKTY*

Protein Structures from PDB: proteins of known structure with sequence similarity to PIS1/YPR113W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
PIS1	SGD (2007) Information without a citation in SGD

Mapping Notes

Date	Note
1997-10-20	Edition 14: PIS1 encodes phosphatidylinositol synthase, also known as CDPdiacylglycerol-inositol 3-phosphatidyltransferase Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPR113W	SGD Systematic Sequence
856229	NCBI: Gene ID
NP_015438.1	NCBI: RefSeq protein version ID
NP_015438.1	NCBI: RefSeq protein version ID
6325370	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
42 curated references; 0 references not yet curated
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |MORE
Reviews	Eide DJ (2009) Homeostatic and Adaptive Responses to Zinc Deficiency in Saccharomyces cerevisiae. J Biol Chem 284(28):18565-9	|ADH1 |ADH2 |ADH3 |ADH4 |CHO1 |CHO2 |CKI1 |CTT1 |DPP1 |EKI1 |FET4 |HPF1 |MCD4 |MET14 |MORE
Regulation of	Guzinska K, et al. (2009) Role of Plc1p in regulation of Mcm1p-dependent genes. FEMS Microbiol Lett 295(2):245-50	|ARG82 |BAR1 |CDC6 |CLN3 |FAR1 |MCM1 |MF(ALPHA)1 |PLC1 |STE2 |STE3
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Jani NM and Lopes JM (2009) Regulated transcription of the Saccharomyces cerevisiae phosphatidylinositol biosynthetic gene, PIS1, yields pleiotropic effects on phospholipid synthesis. FEMS Yeast Res 9(4):552-64	|CHO1 |INO1 |INO2
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Regulation of Transcription	Jani NM and Lopes JM (2008) Transcription regulation of the Saccharomyces cerevisiae PIS1 gene by inositol and the pleiotropic regulator, Ume6p. Mol Microbiol 70(6):1529-39	|ASH1 |CTI6 |DEP1 |EAF3 |INO4 |PHO23 |RCO1 |RPD3 |RXT2 |RXT3 |SAP30 |SDS3 |SIN3 |UME1 |MORE
Reviews	Carman GM and Han GS (2007) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc depletion. Biochim Biophys Acta 1771(3):322-30	|CDS1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |DPP1 |EKI1 |EPT1 |INM1 |INO1 |OPI1 |OPI3 |PAH1 |MORE
Reviews Transcription	Chen M, et al. (2007) Transcriptional regulation of yeast phospholipid biosynthetic genes. Biochim Biophys Acta 1771(3):310-21	|INO1 |INO2 |INO4 |OPI1
Cross-species Expression Non-Fungal Related Genes/Proteins	Wengelnik K and Vial HJ (2007) Characterisation of the phosphatidylinositol synthase gene of Plasmodium species. Res Microbiol 158(1):51-9
DNA/RNA Sequence Features RNA Levels and Processing Strains/Constructs	Iverson S, et al. (2006) Expression of the Saccharomyces cerevisiae PIS1 gene is modulated by multiple ATGs in the promoter. Biochem Biophys Res Commun 350(1):91-6
Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Kaliszewski P, et al. (2006) Enhanced levels of Pis1p (phosphatidylinositol synthase) improve the growth of Saccharomyces cerevisiae cells deficient in Rsp5 ubiquitin ligase. Biochem J 395(1):173-81	|INO1 |RSP5
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Reviews	Carman GM (2005) Regulation of phospholipid synthesis in yeast by zinc. Biochem Soc Trans 33(Pt 5):1150-3	|CHO1 |DPP1 |INO2 |INO4 |OPI1
DNA/RNA Sequence Features Function/Process RNA Levels and Processing Regulation of Strains/Constructs Transcription	Gardocki ME, et al. (2005) Genomic analysis of PIS1 gene expression. Eukaryot Cell 4(3):604-14	|AAD4 |ACB1 |ACE2 |ADH2 |APT1 |ATG17 |ATG19 |ATG27 |ATG29 |BAS1 |CIK1 |COQ4 |CPD1 |CPS1 |MORE
Reviews	Gardocki ME, et al. (2005) Phosphatidylinositol biosynthesis: biochemistry and regulation. Biochim Biophys Acta 1735(2):89-100
Regulation of Transcription	Han SH, et al. (2005) Regulation of the PIS1-encoded phosphatidylinositol synthase in Saccharomyces cerevisiae by zinc. J Biol Chem 280(32):29017-24	|INO2 |INO4 |OPI1 |ZAP1 |ZRT1 |ZRT2
Function/Process Mutants/Phenotypes Strains/Constructs	Loewen CJ, et al. (2004) Phospholipid metabolism regulated by a transcription factor sensing phosphatidic acid. Science 304(5677):1644-7	|OPI1 |SCS2 |SPO14
DNA/RNA Sequence Features Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Gardocki ME and Lopes JM (2003) Expression of the yeast PIS1 gene requires multiple regulatory elements including a Rox1p binding site. J Biol Chem 278(40):38646-52	|ROX1
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Seron K, et al. (2000) Molecular cloning, functional complementation in Saccharomyces cerevisiae and enzymatic properties of phosphatidylinositol synthase from the protozoan parasite Toxoplasma gondii. Eur J Biochem 267(22):6571-9
Cross-species Expression Non-Fungal Related Genes/Proteins	Xue HW, et al. (2000) Cloning of Arabidopsis thaliana phosphatidylinositol synthase and functional expression in the yeast pis mutant. Plant Mol Biol 42(5):757-64
Function/Process Mutants/Phenotypes Strains/Constructs	Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9	|ALG1 |ALG7 |DPM1 |GAA1 |GPI2 |SEC59 |SPT14 |WBP1
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Williams JG and McMaster CR (1998) Scanning alanine mutagenesis of the CDP-alcohol phosphotransferase motif of Saccharomyces cerevisiae cholinephosphotransferase. J Biol Chem 273(22):13482-7	|CHO1 |CPT1 |EPT1
Reviews	Nikawa J and Yamashita S (1997) Phosphatidylinositol synthase from yeast. Biochim Biophys Acta 1348(1-2):173-8
RNA Levels and Processing Regulation of Transcription	Shen H and Dowhan W (1997) Regulation of phospholipid biosynthetic enzymes by the level of CDP-diacylglycerol synthase activity. J Biol Chem 272(17):11215-20	|CDS1 |CHO1 |INO1 |INO2 |OPI1
DNA/RNA Sequence Features RNA Levels and Processing Regulation of Transcription	Anderson MS and Lopes JM (1996) Carbon source regulation of PIS1 gene expression in Saccharomyces cerevisiae involves the MCM1 gene and the two-component regulatory gene, SLN1. J Biol Chem 271(43):26596-601	|INO2 |MCM1 |OPI1 |SLN1
Function/Process Fungal Related Genes/Proteins	Antonsson BE and Klig LS (1996) Candida albicans phosphatidylinositol synthase has common features with both Saccharomyces cerevisiae and mammalian phosphatidylinositol synthases. Yeast 12(5):449-56
Reviews	Greenberg ML and Lopes JM (1996) Genetic regulation of phospholipid biosynthesis in Saccharomyces cerevisiae. Microbiol Rev 60(1):1-20	|HNM1 |INO1 |ITR1 |PCT1 |PSD1 |PSD2
Mapping	Anderson MS, et al. (1995) Physical map locations of the phospholipid biosynthetic structural and regulatory genes of Saccharomyces cerevisiae. Yeast 11(2):187-90	|CHO2 |INO1 |OPI3 |UME6
Cellular Location	Gaigg B, et al. (1995) Characterization of a microsomal subfraction associated with mitochondria of the yeast, Saccharomyces cerevisiae. Involvement in synthesis and import of phospholipids into mitochondria. Biochim Biophys Acta 1234(2):214-20	|CHO1
Cellular Location	Leber A, et al. (1995) Phospholipid-synthesizing enzymes in Golgi membranes of the yeast, Saccharomyces cerevisiae. FEBS Lett 377(2):271-4	|CPT1 |GDA1
Protein-Nucleic Acid Interactions RNA Levels and Processing Regulation of Transcription	Kuo MH and Grayhack E (1994) A library of yeast genomic MCM1 binding sites contains genes involved in cell cycle control, cell wall and membrane structure, and metabolism. Mol Cell Biol 14(1):348-59	|CCP1 |CLB2 |CLN3 |DIT1 |DIT2 |FAR1 |GFA1 |HSP150 |MCM1 |MET2 |PCK1 |PMA1
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Bae-Lee M and Carman GM (1990) Regulation of yeast phosphatidylserine synthase and phosphatidylinositol synthase activities by phospholipids in Triton X-100/phospholipid mixed micelles. J Biol Chem 265(13):7221-6	|CHO1
Cellular Location Techniques and Reagents	Kinney AJ and Carman GM (1990) Enzymes of phosphoinositide synthesis in secretory vesicles destined for the plasma membrane in Saccharomyces cerevisiae. J Bacteriol 172(7):4115-7	|CDS1 |PIK1
Protein Physical Properties Protein Processing/Modification/Regulation Regulation of Substrates/Ligands/Cofactors	Kelley MJ, et al. (1988) Regulation of phospholipid biosynthesis in Saccharomyces cerevisiae by inositol. Inositol is an inhibitor of phosphatidylserine synthase activity. J Biol Chem 263(34):18078-85	|CHO1
Function/Process Protein Physical Properties Strains/Constructs Techniques and Reagents	Nikawa J, et al. (1988) Expression of the Saccharomyces cerevisiae PIS gene and synthesis of phosphatidylinositol in Escherichia coli. J Bacteriol 170(10):4727-31
Cellular Location DNA/RNA Sequence Features Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features RNA Levels and Processing Strains/Constructs	Nikawa J, et al. (1987) Primary structure and disruption of the phosphatidylinositol synthase gene of Saccharomyces cerevisiae. J Biol Chem 262(10):4876-81
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Fischl AS, et al. (1986) Phosphatidylinositol synthase from Saccharomyces cerevisiae. Reconstitution, characterization, and regulation of activity. J Biol Chem 261(7):3178-83
Cellular Location	Kuchler K, et al. (1986) Subcellular and submitochondrial localization of phospholipid-synthesizing enzymes in Saccharomyces cerevisiae. J Bacteriol 165(3):901-10	|CDS1 |CHO1 |CPT1 |GAT1 |PSD1 |PSD2
DNA/RNA Sequence Features Function/Process Protein Physical Properties Protein Sequence Features Strains/Constructs	Nikawa J and Yamashita S (1984) Molecular cloning of the gene encoding CDPdiacylglycerol-inositol 3-phosphatidyl transferase in Saccharomyces cerevisiae. Eur J Biochem 143(2):251-6
Function/Process Mapping Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Nikawa J and Yamashita S (1982) Yeast mutant defective in synthesis of phosphatidylinositol. Isolation and characterization of a CDPdiacylglycerol--inositol 3-phosphatidyltransferase Km mutant. Eur J Biochem 125(2):445-51	|CHO1 |HOM3 |URA3

Return to SGD

Send a Message to the SGD Curators