---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SRP68/YPL243W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 88517 to 90316 CDS: 88517 - 90316 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SRP68	YPL243W		ORF, Verified	S000006164
Description
Core component of the signal recognition particle (SRP) ribonucleoprotein (RNP) complex that functions in targeting nascent secretory proteins to the endoplasmic reticulum (ER) membrane

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By RNA binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0694 Assigned on 2007-05-23 UniProtKB signal sequence binding Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IPI : Inferred from Physical Interaction Assigned on 2003-05-27 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IC : Inferred By Curator from signal recognition particle, endoplasmic reticulum targeting Assigned on 2005-01-28 SGD protein targeting to ER Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IPI : Inferred from Physical Interaction Assigned on 2002-06-20 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0086 Assigned on 2008-02-13 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0191 Assigned on 2008-02-13 UniProtKB ribonucleoprotein complex GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0687 Assigned on 2007-05-23 UniProtKB signal recognition particle, endoplasmic reticulum targeting Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      IDA : Inferred from Direct Assay Assigned on 2002-06-20 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0733 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SRP68/YPL243W for SRP68 The signal recognition particle (SRP) is an abundant and conserved ribonucleoprotein necessary for targeting proteins to the endoplasmic reticulum membrane (1). SRP in eukaryotes contains six subunits and a 7S RNA molecule; in S. cerevisiae the subunits are encoded by SRP14, SRP21, SRP68, SRP72, SEC65, and SRP54, and the RNA (termed scR1) is encoded by SCR1 (1, 2). With the exception of Srp54p, the proteins and RNA assemble into a core complex in the nucleus; this particle is exported to the cytoplasm where Srp54p joins to form the complete complex (3). Sec65p is required for association of Srp54p with the SRP particle (4). Loss of any of the SRP components causes a slow growth phenotype and loss of SRP-mediated translocation, but not cell death, indicating that the signal recognition particle is not essential in yeast and SRP-independent translocation can occur (1, 2). The first step of SRP-mediated cotranslational targeting is interaction between SRP and the ribosome nascent chain complex (RNC), which is comprised of the translating ribosome and the emerging nascent protein. SRP interacts with the RNC through the N-terminal hydrophobic signal sequence of the nascent protein. SRP then directs the RNC to the ER membrane via interaction between SRP and a signal receptor complex (SR), encoded by SRP101 and SRP102. Finally, the RNC is transferred to the translocon, a protein-conducting membrane channel, and SRP and the SR dissociate. GTP binding by both SRP (via the Srp54p subunit) and the SR is critical for their interaction, and GTP hydrolysis facilitates their dissociation (reviewed in 5, and see 5 for more details). Last Updated: 2008-08-11

Basic References [TOP]

BASIC INFORMATION REFERENCES forSRP68/YPL243W for SRP68 1) Hann BC and Walter P (1991) The signal recognition particle in S. cerevisiae. Cell 67(1):131-44        2) Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400      3) Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64        4) Stirling CJ and Hewitt EW (1992) The S. cerevisiae SEC65 gene encodes a component of yeast signal recognition particle with homology to human SRP19. Nature 356(6369):534-7      5) Wild K, et al. (2004) SRP meets the ribosome. Nat Struct Mol Biol 11(11):1049-53        6) Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SRP68/YPL243W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SRP68/YPL243W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVAYSPI C-term FLGLFGR Length(aa) 599 MW(Da) 69,005 pI 9.44 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.112   Codon Adaptation Index 0.176   Frequency of Optimal Codons 0.474   Hydropathicity of Protein -0.509   Aromaticity Score 0.082

10 20 30 40 50 | | | | | MVAYSPIIATYGNRAEQFLETDSDFAKYHAKLNKKLQHLRSRCHLVTKDT KKYSSKNKYGEINSEDYDNKTKLIGVLILLHAERDLALAETLKLRARQRG KLKKSEEKVLSTRLKKACKTADKLVNVTQNEQQWITRAQYLAFAKLVHSE YLINGKRFKRKDNAKISNNLALVFAALEHLKNLSLLAEEVVDNIVNKYQY SLKQYAGNLITTPEINNFIVERVQSDENKDDELVKLLLDNGFNMKKITTS TEDQKVTTNINWRSFNAKIIDAEVAQFLEQGLSIHPTQITQYTQRLSKLE KALDRHEFFIANHDDQDDIDEMVENSSENNQIILAYIKYNILLTSISRER DLFTHLWNQWLKLNTSLPSKLTKYKEMERIVKNLTKYLSDIMELPGVYSD DELLSQLDLCKLYFQLFLNTGCLSVLYQSKGRYMEALALYVDAYRRLENK LSEIESLDEILLPANLLSLNSVRSLQKRIENGGNSVITLAEYEKRNHGGS LGKYDLTVIEKLDSKKILPTDIQLKNLFPLKPKMLPIPSKPTLFDLAFNY ITYDKQEPSASQVKDSVTETESISQTPISNEQTEGEPKKKRGFLGLFGR*

Protein Structures from PDB: proteins of known structure with sequence similarity to SRP68/YPL243W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SRP68	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPL243W	SGD Systematic Sequence
855833	NCBI: Gene ID
NP_015081.1	NCBI: RefSeq protein version ID
NP_015081.1	NCBI: RefSeq protein version ID
6325013	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
9 curated references; 0 references not yet curated
Reviews	Fonzi WA (2009) The protein secretory pathway of Candida albicans. Mycoses	|BTT1 |EGD1 |EGD2 |GEA1 |GEA2 |GSG1 |NCE101 |NCE102 |SCR1 |SEC14 |SEC3 |SEC4 |SEC61 |SEC65 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Reviews	Pool MR (2005) Signal recognition particles in chloroplasts, bacteria, yeast and mammals (review). Mol Membr Biol 22(1-2):3-15	|SCR1 |SEC65 |SRP101 |SRP14 |SRP21 |SRP54 |SRP72
Function/Process Mutants/Phenotypes Strains/Constructs	Willer M, et al. (2003) An in vitro assay using overexpressed yeast SRP demonstrates that cotranslational translocation is dependent upon the J-domain of Sec63p. Biochemistry 42(23):7171-7	|SCR1 |SEC63 |SEC65 |SRP14 |SRP21 |SRP54 |SRP72
Function/Process Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs	Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62	|CRM1 |DIS3 |KAP123 |MEX67 |MTR10 |NSP1 |NUP159 |NUP85 |PSE1 |RNA1 |RRP4 |SCR1 |SEC65 |SRM1 |MORE
Cellular Location Function/Process Protein Processing/Modification/Regulation Techniques and Reagents	Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64	|CRM1 |SCR1 |SEC65 |SRP14 |SRP21 |SRP54 |SRP72 |YRB2
Reviews	Lewis JD and Tollervey D (2000) Like attracts like: getting RNA processing together in the nucleus. Science 288(5470):1385-9	|NOP1 |NSR1 |SRP72
DNA/RNA Sequence Features Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein-protein Interactions Regulatory Role Techniques and Reagents	Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400	|SCR1 |SEC65 |SRP14 |SRP21 |SRP54 |SRP72

Return to SGD

Send a Message to the SGD Curators