SRP72/YPL210C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXVI: 156211 to 154289
CDS: 156211 - 154289

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SRP72 YPL210C ORF, Verified S000006131

Description
Core component of the signal recognition particle (SRP) ribonucleoprotein (RNP) complex that functions in targeting nascent secretory proteins to the endoplasmic reticulum (ER) membrane

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
7S RNA binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR013699
Assigned on 2008-02-13 UniProtKB
signal sequence binding Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400
     IPI : Inferred from Physical Interaction
Assigned on 2003-05-27 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
SRP-dependent cotranslational protein targeting to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR013699
Assigned on 2008-02-13 UniProtKB
SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400
     IC : Inferred By Curator from signal recognition particle, endoplasmic reticulum targeting
Assigned on 2005-01-28 SGD
protein targeting to ER Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400
     IPI : Inferred from Physical Interaction
Assigned on 2002-06-20 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0963
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0086
Assigned on 2008-02-13 UniProtKB
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
endoplasmic reticulum membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0097
Assigned on 2008-10-06 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2008-10-02 UniProtKB
nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0191
Assigned on 2008-02-13 UniProtKB
ribonucleoprotein complex GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0687
Assigned on 2007-05-23 UniProtKB
signal recognition particle DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR013699
Assigned on 2008-02-13 UniProtKB
signal recognition particle, endoplasmic reticulum targeting Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400
     IDA : Inferred from Direct Assay
Assigned on 2002-06-20 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0733
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for SRP72/YPL210C for SRP72
The signal recognition particle (SRP) is an abundant and conserved ribonucleoprotein necessary for targeting proteins to the endoplasmic reticulum membrane (1). SRP in eukaryotes contains six subunits and a 7S RNA molecule; in S. cerevisiae the subunits are encoded by SRP14, SRP21, SRP68, SRP72, SEC65, and SRP54, and the RNA (termed scR1) is encoded by SCR1 (1, 2). With the exception of Srp54p, the proteins and RNA assemble into a core complex in the nucleus; this particle is exported to the cytoplasm where Srp54p joins to form the complete complex (3). Sec65p is required for association of Srp54p with the SRP particle (4). Loss of any of the SRP components causes a slow growth phenotype and loss of SRP-mediated translocation, but not cell death, indicating that the signal recognition particle is not essential in yeast and SRP-independent translocation can occur (1, 2).
The first step of SRP-mediated cotranslational targeting is interaction between SRP and the ribosome nascent chain complex (RNC), which is comprised of the translating ribosome and the emerging nascent protein. SRP interacts with the RNC through the N-terminal hydrophobic signal sequence of the nascent protein. SRP then directs the RNC to the ER membrane via interaction between SRP and a signal receptor complex (SR), encoded by SRP101 and SRP102. Finally, the RNC is transferred to the translocon, a protein-conducting membrane channel, and SRP and the SR dissociate. GTP binding by both SRP (via the Srp54p subunit) and the SR is critical for their interaction, and GTP hydrolysis facilitates their dissociation (reviewed in 5, and see 5 for more details).
Last Updated: 2008-08-11

Basic References [TOP]
BASIC INFORMATION REFERENCES forSRP72/YPL210C for SRP72
1) Hann BC and Walter P (1991) The signal recognition particle in S. cerevisiae. Cell 67(1):131-44

2) Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400

3) Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64

4) Stirling CJ and Hewitt EW (1992) The S. cerevisiae SEC65 gene encodes a component of yeast signal recognition particle with homology to human SRP19. Nature 356(6369):534-7

5) Wild K, et al. (2004) SRP meets the ribosome. Nat Struct Mol Biol 11(11):1049-53

6) Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SRP72/YPL210C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SRP72/YPL210C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAKDNLT

C-term NKKKGRK

Length(aa) 640

MW(Da) 73,540

pI 10.21

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.102

Codon Adaptation Index 0.171

Frequency of Optimal Codons 0.470

Hydropathicity of Protein -0.501

Aromaticity Score 0.080

10 20 30 40 50 | | | | | MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPADVFRRCLVA VIQQDKYQKALHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYT AIITDDLDTVLKKDIESLRGILHVRAQYCYKNGLYQEAFKIYQHLASHNE KDQDSQIELSCNERVPLSVATELMNRSPLVTPMDESSYDLLFNESFIMAS VGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQMVGKTAQSKEI LKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTF NLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVT LESYKTQAKKLYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRI GELFLNESWKSSFEKFNDSQAIVCYILFELYKIKGRNNSKSVLLKKLGSV RVQLSGKIQENIPFWKHVGFELLSMGNAKESKALLREISNFSKGDADVLV DRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKRSKNTAVSKVQ KRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQ GAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK*

Protein Structures from PDB: proteins of known structure with sequence similarity to SRP72/YPL210C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SRP72 SGD (2007) Information without a citation in SGD

Sequence Annotation Notes
Date Note
2008-10-28 RNA sequencing data from Nagalakshmi et al. 2008 suggest that there is an in-frame AUG 6 codons upstream of the currently annotated AUG for either all or some of the transcripts of SRP72/YPL210C. The upstream AUG represents the previously annotated start for this ORF, the annotation of which was changed based on comparative DNA sequence data from Kellis et al. 2003 and Cliften et al. 2003.
Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54

Cliften P, et al. (2003) Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6

Nagalakshmi U, et al. (2008) The transcriptional landscape of the yeast genome defined by RNA sequencing. Science 320(5881):1344-9

2003-09-22 Based on the automated comparison of closely related Saccharomyces species, Kellis et al. suggest that the start site for SRP72/YPL210C be moved 18 nt (6 codons) downstream. This suggestion was reviewed and accepted by SGD curators. The numbering for both the nucleotides in the DNA coding sequence and the amino acids in the predicted protein have been changed accordingly. Evidence supporting this change includes: 1) This is the predicted start methionine in the majority of Saccharomyces species orthologs analyzed by Kellis et al. and/or Cliften et al.; 2) Significant sequence conservation begins abruptly at this predicted start methionine; 3) The first ATG at 156229 is not conserved in the other Saccharomyces species; 4) Protein sequence comparisons against the nr dataset show that sequence similarity begins after 156211 between S. cerevisiae YPL210C and related proteins.
Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54

Cliften P, et al. (2003) Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6

Standard Name	Reference
SRP72	SGD (2007) Information without a citation in SGD

Date	Note
2008-10-28	RNA sequencing data from Nagalakshmi et al. 2008 suggest that there is an in-frame AUG 6 codons upstream of the currently annotated AUG for either all or some of the transcripts of SRP72/YPL210C. The upstream AUG represents the previously annotated start for this ORF, the annotation of which was changed based on comparative DNA sequence data from Kellis et al. 2003 and Cliften et al. 2003. *Kellis M, et al.* (2003)** Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54 *Cliften P, et al.* (2003)** Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6 *Nagalakshmi U, et al.* (2008)** The transcriptional landscape of the yeast genome defined by RNA sequencing. Science 320(5881):1344-9
2003-09-22	Based on the automated comparison of closely related Saccharomyces species, Kellis et al. suggest that the start site for SRP72/YPL210C be moved 18 nt (6 codons) downstream. This suggestion was reviewed and accepted by SGD curators. The numbering for both the nucleotides in the DNA coding sequence and the amino acids in the predicted protein have been changed accordingly. Evidence supporting this change includes: 1) This is the predicted start methionine in the majority of Saccharomyces species orthologs analyzed by Kellis et al. and/or Cliften et al.; 2) Significant sequence conservation begins abruptly at this predicted start methionine; 3) The first ATG at 156229 is not conserved in the other Saccharomyces species; 4) Protein sequence comparisons against the nr dataset show that sequence similarity begins after 156211 between S. cerevisiae YPL210C and related proteins. *Kellis M, et al.* (2003)** Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54 *Cliften P, et al.* (2003)** Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YPL210C SGD Systematic Sequence

855891 NCBI: Gene ID

NP_015114.2 NCBI: RefSeq protein version ID

NP_015114.2 NCBI: RefSeq protein version ID

37362700 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YPL210C	SGD Systematic Sequence
855891	NCBI: Gene ID
NP_015114.2	NCBI: RefSeq protein version ID
NP_015114.2	NCBI: RefSeq protein version ID
37362700	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
14 curated references; 0 references not yet curated
Reviews
Fonzi WA (2009) The protein secretory pathway of Candida albicans. Mycoses
     |BTT1 |EGD1 |EGD2 |GEA1 |GEA2 |GSG1 |NCE101 |NCE102 |SCR1 |SEC14 |SEC3 |SEC4 |SEC61 |SEC65 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Fungal Related Genes/Proteins
Ruiz-Pavon L and Dominguez A (2007) Characterization of the Yarrowia lipolytica YlSRP72 gene, a component of the yeast signal recognition particle. Int Microbiol 10(4):283-9

Regulation of
Strains/Constructs
Transcription
Kovalskaya ON, et al. (2006) Does a deficiency of the signal recognition particle (SRP)-pathway affect the biosynthesis of its components in Saccharomyces cerevisiae and Escherichia coli? Biochemistry (Mosc) 71(7):723-9
         |SCR1 |SEC65 |SRP101 |SRP14 |SRP21
Function/Process
Mutants/Phenotypes
Strains/Constructs
Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7
           |ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Reviews
Pool MR (2005) Signal recognition particles in chloroplasts, bacteria, yeast and mammals (review). Mol Membr Biol 22(1-2):3-15
         |SCR1 |SEC65 |SRP101 |SRP14 |SRP21 |SRP54 |SRP68
DNA/RNA Sequence Features
Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54
           |AAT2 |API2 |ASA1 |ASR1 |ATG4 |AUA1 |AVT5 |BLM10 |BUD19 |CAT5 |CBS1 |CIN8 |COG2 |COQ3 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Willer M, et al. (2003) An in vitro assay using overexpressed yeast SRP demonstrates that cotranslational translocation is dependent upon the J-domain of Sec63p. Biochemistry 42(23):7171-7
     |SCR1 |SEC63 |SEC65 |SRP14 |SRP21 |SRP54 |SRP68
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-Nucleic Acid Interactions
Protein-protein Interactions
Strains/Constructs
Grosshans H, et al. (2001) Biogenesis of the signal recognition particle (SRP) involves import of SRP proteins into the nucleolus, assembly with the SRP-RNA, and Xpo1p-mediated export. J Cell Biol 153(4):745-62
       |CRM1 |DIS3 |KAP123 |MEX67 |MTR10 |NSP1 |NUP159 |NUP85 |PSE1 |RNA1 |RRP4 |SCR1 |SEC65 |SRM1 |MORE
Cellular Location
Function/Process
Protein Processing/Modification/Regulation
Techniques and Reagents
Ciufo LF and Brown JD (2000) Nuclear export of yeast signal recognition particle lacking Srp54p by the Xpo1p/Crm1p NES-dependent pathway. Curr Biol 10(20):1256-64
       |CRM1 |SCR1 |SEC65 |SRP14 |SRP21 |SRP54 |SRP68 |YRB2
Reviews
Lewis JD and Tollervey D (2000) Like attracts like: getting RNA processing together in the nucleus. Science 288(5470):1385-9
       |NOP1 |NSR1 |SRP68
Function/Process
Mason N, et al. (2000) Elongation arrest is a physiologically important function of signal recognition particle. EMBO J 19(15):4164-74
       |SRP14
DNA/RNA Sequence Features
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Protein-protein Interactions
Regulatory Role
Techniques and Reagents
Brown JD, et al. (1994) Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. EMBO J 13(18):4390-400
     |SCR1 |SEC65 |SRP14 |SRP21 |SRP54 |SRP68

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.