---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SPT14/YPL175W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 218629 to 220087 intron: 218646 - 218745 CDS: 218629 - 218645, 218746 - 220087 Genetic position: -113 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SPT14	YPL175W	CWH6, GPI3	ORF, Verified	S000006096
Description
UDP-GlcNAc-binding and catalytic subunit of the enzyme that mediates the first step in glycosylphosphatidylinositol (GPI) biosynthesis, mutations cause defects in transcription and in biogenesis of cell wall proteins

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By UDP-glycosyltransferase activity Kostova Z, et al. (2000) Photoaffinity labelling with P3-(4-azidoanilido)uridine 5'-triphosphate identifies gpi3p as the UDP-GlcNAc-binding subunit of the enzyme that catalyses formation of GlcNAc-phosphatidylinositol, the first glycolipid intermediate in glycosylphosphatidylinositol synthesis. Biochem J 350 Pt 3():815-22        ISS : Inferred from Sequence or structural Similarity IPI : Inferred from Physical Interaction Assigned on 2005-07-13 SGD phosphatidylinositol N-acetylglucosaminyltransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.198 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By GPI anchor biosynthetic process Inoue N, et al. (1996) PIG-C, one of the three human genes involved in the first step of glycosylphosphatidylinositol biosynthesis is a homologue of Saccharomyces cerevisiae GPI2. Biochem Biophys Res Commun 226(1):193-9        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013234 Assigned on 2008-10-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0337 Assigned on 2007-05-23 UniProtKB biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001296 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Vossen JH, et al. (1997) Restrictive glycosylphosphatidylinositol anchor synthesis in cwh6/gpi3 yeast cells causes aberrant biogenesis of cell wall proteins. J Bacteriol 179(7):2202-9        IMP : Inferred from Mutant Phenotype Assigned on 2002-08-13 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2009-06-29 UniProtKB glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8        TAS : Traceable Author Statement Assigned on 2005-07-13 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2009-06-29 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9904 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SPT14/YPL175W for SPT14 SPT14 is one member of a large class of SPT genes, which were named for their ability to suppress the phenotypes resulting from Ty insertions that disrupted transcription of nearby genes (1, 2). The role Spt14p plays in transcription is likely an indirect one, as it has been found to encode a glycosyl transferase that transfers N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidyl inositol, the first step of glycosyl phosphatidyl inositol (GPI) biosynthesis (3, 4). This reaction requires the action of at least three gene products in yeast (Gpi1p, Gpi2p, and Spt14p) and human (PIG-C, PIG-H, and PIG-A) (3, 5). Spt14p shows high similarity to the human PIG-A protein, mutations in which are responsible for the disease paroxysmal nocturnal hemoglobinuria (4, 6, 7). Because GPI acts as a membrane anchor for many proteins, spt14 mutants have defects in GPI anchoring, and in the release of cell wall proteins from the endoplasmic reticulum (4, 8). Last Updated: 2000-03-10

Basic References [TOP]

BASIC INFORMATION REFERENCES forSPT14/YPL175W for SPT14 1) Fassler JS and Winston F (1988) Isolation and analysis of a novel class of suppressor of Ty insertion mutations in Saccharomyces cerevisiae. Genetics 118(2):203-12      2) Winston F and Sudarsanam P (1998) The SAGA of Spt proteins and transcriptional analysis in yeast: past, present, and future. Cold Spring Harb Symp Quant Biol 63:553-61      3) Inoue N, et al. (1996) PIG-C, one of the three human genes involved in the first step of glycosylphosphatidylinositol biosynthesis is a homologue of Saccharomyces cerevisiae GPI2. Biochem Biophys Res Commun 226(1):193-9        4) Schonbachler M, et al. (1995) The yeast spt14 gene is homologous to the human PIG-A gene and is required for GPI anchor synthesis. EMBO J 14(8):1637-45      5) Leidich SD, et al. (1995) Temperature-sensitive yeast GPI anchoring mutants gpi2 and gpi3 are defective in the synthesis of N-acetylglucosaminyl phosphatidylinositol. Cloning of the GPI2 gene. J Biol Chem 270(22):13029-35        6) Kawagoe K, et al. (1994) Molecular cloning of murine pig-a, a gene for GPI-anchor biosynthesis, and demonstration of interspecies conservation of its structure, function, and genetic locus. Genomics 23(3):566-74      7) Bessler M, et al. (1994) Genomic organization of the X-linked gene (PIG-A) that is mutated in paroxysmal nocturnal haemoglobinuria and of a related autosomal pseudogene mapped to 12q21. Hum Mol Genet 3(5):751-7      8) Vossen JH, et al. (1997) Restrictive glycosylphosphatidylinositol anchor synthesis in cwh6/gpi3 yeast cells causes aberrant biogenesis of cell wall proteins. J Bacteriol 179(7):2202-9        9) Vossen JH, et al. (1995) Identification of SPT14/CWH6 as the yeast homologue of hPIG-A, a gene involved in the biosynthesis of GPI anchors. Biochim Biophys Acta 1243(3):549-51      10) Kostova Z, et al. (2000) Photoaffinity labelling with P3-(4-azidoanilido)uridine 5'-triphosphate identifies gpi3p as the UDP-GlcNAc-binding subunit of the enzyme that catalyses formation of GlcNAc-phosphatidylinositol, the first glycolipid intermediate in glycosylphosphatidylinositol synthesis. Biochem J 350 Pt 3():815-22

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SPT14/YPL175W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SPT14/YPL175W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MGFNIAM C-term TKEARET Length(aa) 452 MW(Da) 51,242 pI 7.25 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.013   Codon Adaptation Index 0.121   Frequency of Optimal Codons 0.428   Hydropathicity of Protein 0.006   Aromaticity Score 0.093

10 20 30 40 50 | | | | | MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGV RHLTNGLKVYHVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGS ASTFAHEGILHANTMGLRTVFTDHSLYGFNNLTSIWVNKLLTFTLTNIDR VICVSNTCKENMIVRTELSPDIISVIPNAVVSEDFKPRDPTGGTKRKQSR DKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAGDGPKFIDFQQ MIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAAS CNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAINIIRSKALD TSSFHDSVSKMYDWMDVAKRTVEIYTNISSTSSADDKDWMKMVANLYKRD GIWAKHLYLLCGIVEYMLFFLLEWLYPRDEIDLAPKWPKKTVSNETKEAR ET*

Protein Structures from PDB: proteins of known structure with sequence similarity to SPT14/YPL175W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to SPT14 Homolog Source (per PDB) Protein Alignment: SPT14 vs. Homolog External Links P-Value %Identical %Similar Alignment 2jjm ( Chain: J, I, H, D, G, E, A, C, F, K, B, L) Crystal structure of a family gt4 glycosyltransferase from bacillus anthracis orf ba1558. PDB_Info PDB_Structure Bacillus anthracis Chain J = 9.2e-16 24 35 View alignment SCOP MMDB CATH Chain I = 9.2e-16 24 35 View alignment Chain H = 9.2e-16 24 35 View alignment Chain D = 9.2e-16 24 35 View alignment Chain G = 9.2e-16 24 35 View alignment Chain E = 9.2e-16 24 35 View alignment Chain A = 9.2e-16 24 35 View alignment Chain C = 9.2e-16 24 35 View alignment Chain F = 9.2e-16 24 35 View alignment Chain K = 9.2e-16 24 35 View alignment Chain B = 9.2e-16 24 35 View alignment Chain L = 9.2e-16 24 35 View alignment 2gej ( Chain: A) Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp-man PDB_Info PDB_Structure Mycobacterium smegmatis str. MC2 155 2.8e-10 22 31 View alignment SCOP MMDB CATH 2gek ( Chain: A) Crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp PDB_Info PDB_Structure Mycobacterium smegmatis str. MC2 155 2.8e-10 22 31 View alignment SCOP MMDB CATH 3c4q ( Chain: B, A) Structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp PDB_Info PDB_Structure Corynebacterium glutamicum Chain B = 5.1e-09 23 31 View alignment SCOP MMDB CATH Chain A = 5.1e-09 23 31 View alignment 3c4v ( Chain: A, B) Structure of the retaining glycosyltransferase msha:the first step in mycothiol biosynthesis. organism: corynebacterium glutamicum : complex with udp and 1l-ins-1- p. PDB_Info PDB_Structure Corynebacterium glutamicum Chain A = 5.1e-09 23 31 View alignment SCOP MMDB CATH Chain B = 5.1e-09 23 31 View alignment 3c48 ( Chain: B, A) Structure of the retaining glycosyltransferase msha: the first step in mycothiol biosynthesis. organism: corynebacterium glutamicum- apo (open) structure. PDB_Info PDB_Structure Corynebacterium glutamicum Chain B = 5.3e-09 23 31 View alignment SCOP MMDB CATH Chain A = 5.3e-09 23 31 View alignment 2bis ( Chain: A, C, B) Structure of glycogen synthase from pyrococcus abyssi PDB_Info PDB_Structure Pyrococcus abyssi Chain A = 4.3e-07 23 30 View alignment SCOP MMDB CATH Chain C = 4.3e-07 23 30 View alignment Chain B = 4.3e-07 23 30 View alignment 2bfw ( Chain: A) Structure of the c domain of glycogen synthase from pyrococcus abyssi PDB_Info PDB_Structure Pyrococcus abyssi 1.9e-05 26 36 View alignment SCOP MMDB CATH 2r60 ( Chain: A) Structure of apo sucrose phosphate synthase (sps) of halothermothrix orenii PDB_Info PDB_Structure Halothermothrix orenii 5.6e-05 21 30 View alignment SCOP MMDB CATH 2r68 ( Chain: A) Complex structure of sucrose phosphate synthase (sps)-s6p of halothermothrix orenii PDB_Info PDB_Structure Halothermothrix orenii H 168 5.6e-05 21 30 View alignment SCOP MMDB CATH 2r66 ( Chain: A) Complex structure of sucrose phosphate synthase (sps)-f6p of halothermothrix orenii PDB_Info PDB_Structure Halothermothrix orenii 5.6e-05 21 30 View alignment SCOP MMDB CATH 2iw1 ( Chain: A) Crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis PDB_Info PDB_Structure Escherichia coli 0.000549 27 30 View alignment SCOP MMDB CATH 2iv7 ( Chain: A) Crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis PDB_Info PDB_Structure Escherichia coli 0.000549 27 30 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SPT14	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPL175W	SGD Systematic Sequence
855928	NCBI: Gene ID
NP_015150.2	NCBI: RefSeq protein version ID
NP_015150.2	NCBI: RefSeq protein version ID
9755344	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
35 curated references; 0 references not yet curated
Reviews	Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett	|ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kajiwara K, et al. (2008) Yeast ARV1 Is Required for Efficient Delivery of an Early GPI Intermediate to the First Mannosyltransferase during GPI Assembly and Controls Lipid Flow from the Endoplasmic Reticulum. Mol Biol Cell 19(5):2069-82	|ARV1 |ERI1 |GAA1 |GAS1 |GPI15 |GPI2 |GWT1 |LAS21 |PMI40 |YPS1
Reviews	Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209	|BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Fungal Related Genes/Proteins	Li H, et al. (2007) Glycosylphosphatidylinositol (GPI) anchor is required in Aspergillus fumigatus for morphogenesis and virulence. Mol Microbiol 64(4):1014-27
Reviews	Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |MORE
Reviews	Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Breinig F, et al. (2004) Yeast Kre1p is GPI-anchored and involved in both cell wall assembly and architecture. Microbiology 150(Pt 10):3209-18	|GPI1 |GPI2 |KRE1
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Kostova Z, et al. (2003) Comparative importance in vivo of conserved glutamate residues in the EX7E motif retaining glycosyltransferase Gpi3p, the UDP-GlcNAc-binding subunit of the first enzyme in glycosylphosphatidylinositol assembly. Eur J Biochem 270(22):4507-14
Non-Fungal Related Genes/Proteins	Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22	|DPM1 |GAA1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI8
Alias Function/Process Non-Fungal Related Genes/Proteins	Yan BC, et al. (2001) Ynl038wp (Gpi15p) is the Saccharomyces cerevisiae homologue of human Pig-Hp and participates in the first step in glycosylphosphatidylinositol assembly. Yeast 18(15):1383-9	|GPI1 |GPI15 |GPI2 |SMP3
Function/Process Mutants/Phenotypes Strains/Constructs	Cullen PJ, et al. (2000) Defects in protein glycosylation cause SHO1-dependent activation of a STE12 signaling pathway in yeast. Genetics 155(3):1005-18	|ALG1 |DPM1 |FUS1 |HOG1 |KSS1 |MNN10 |OCH1 |PGI1 |PMI40 |PSA1 |RER2 |SHO1 |STE11 |STE12 |MORE
DNA/RNA Sequence Features	Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6	|AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE
Reviews	Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8	|DPM1 |GAA1 |GPI1 |GPI10 |GPI13 |GPI14 |GPI19 |GPI2 |GPI8 |LAS21 |MCD4 |SMP3
Function/Process Strains/Constructs Substrates/Ligands/Cofactors	Kostova Z, et al. (2000) Photoaffinity labelling with P3-(4-azidoanilido)uridine 5'-triphosphate identifies gpi3p as the UDP-GlcNAc-binding subunit of the enzyme that catalyses formation of GlcNAc-phosphatidylinositol, the first glycolipid intermediate in glycosylphosphatidylinositol synthesis. Biochem J 350 Pt 3():815-22
Non-Fungal Related Genes/Proteins	Franzot SP and Doering TL (1999) Inositol acylation of glycosylphosphatidylinositols in the pathogenic fungus Cryptococcus neoformans and the model yeast Saccharomyces cerevisiae. Biochem J 340 ( Pt 1)():25-32	|GPI1 |GPI2
Function/Process	Gaynor EC, et al. (1999) MCD4 encodes a conserved endoplasmic reticulum membrane protein essential for glycosylphosphatidylinositol anchor synthesis in yeast. Mol Biol Cell 10(3):627-48	|GAS1 |HSP150 |MCD4
Function/Process Mutants/Phenotypes Strains/Constructs	Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9	|ALG1 |ALG7 |DPM1 |GAA1 |GPI2 |PIS1 |SEC59 |WBP1
Disease Gene Related Non-Fungal Related Genes/Proteins	Watanabe R, et al. (1998) The first step of glycosylphosphatidylinositol biosynthesis is mediated by a complex of PIG-A, PIG-H, PIG-C and GPI1. EMBO J 17(4):877-85	|GPI1 |GPI2
Disease Gene Related	Foury F (1997) Human genetic diseases: a cross-talk between man and yeast. Gene 195(1):1-10	|APT1 |ARG1 |ARG3 |ARG4 |CDC19 |CPA2 |CTA1 |CYS4 |HEM12 |HEM13 |HYR1 |INP52 |KGD1 |LAT1 |MORE
Cellular Location Function/Process Mutants/Phenotypes	Vossen JH, et al. (1997) Restrictive glycosylphosphatidylinositol anchor synthesis in cwh6/gpi3 yeast cells causes aberrant biogenesis of cell wall proteins. J Bacteriol 179(7):2202-9	|GAS1
Disease Gene Related Function/Process Non-Fungal Related Genes/Proteins	Inoue N, et al. (1996) PIG-C, one of the three human genes involved in the first step of glycosylphosphatidylinositol biosynthesis is a homologue of Saccharomyces cerevisiae GPI2. Biochem Biophys Res Commun 226(1):193-9	|GPI1 |GPI2
Function/Process Mutants/Phenotypes	Leidich SD and Orlean P (1996) Gpi1, a Saccharomyces cerevisiae protein that participates in the first step in glycosylphosphatidylinositol anchor synthesis. J Biol Chem 271(44):27829-37	|GAS1 |GPI1 |GPI2
Non-Fungal Related Genes/Proteins	Watanabe R, et al. (1996) PIG-A and PIG-H, which participate in glycosylphosphatidylinositol anchor biosynthesis, form a protein complex in the endoplasmic reticulum. J Biol Chem 271(43):26868-75
Other Features Techniques and Reagents	Leidich SD, et al. (1995) Isolation and characterization of yeast glycosylphosphatidylinositol anchoring mutants. Methods Enzymol 250:560-71	|GPI1 |GPI2
Function/Process Genetic Interactions Mutants/Phenotypes	Leidich SD, et al. (1995) Temperature-sensitive yeast GPI anchoring mutants gpi2 and gpi3 are defective in the synthesis of N-acetylglucosaminyl phosphatidylinositol. Cloning of the GPI2 gene. J Biol Chem 270(22):13029-35	|GPI1 |GPI2
Disease Gene Related Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Schonbachler M, et al. (1995) The yeast spt14 gene is homologous to the human PIG-A gene and is required for GPI anchor synthesis. EMBO J 14(8):1637-45
Reviews	Takeda J and Kinoshita T (1995) GPI-anchor biosynthesis. Trends Biochem Sci 20(9):367-71	|GAA1
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Vossen JH, et al. (1995) Identification of SPT14/CWH6 as the yeast homologue of hPIG-A, a gene involved in the biosynthesis of GPI anchors. Biochim Biophys Acta 1243(3):549-51
Disease Gene Related Non-Fungal Related Genes/Proteins	Bessler M, et al. (1994) Genomic organization of the X-linked gene (PIG-A) that is mutated in paroxysmal nocturnal haemoglobinuria and of a related autosomal pseudogene mapped to 12q21. Hum Mol Genet 3(5):751-7
Disease Gene Related Function/Process Non-Fungal Related Genes/Proteins	Kawagoe K, et al. (1994) Molecular cloning of murine pig-a, a gene for GPI-anchor biosynthesis, and demonstration of interspecies conservation of its structure, function, and genetic locus. Genomics 23(3):566-74
Alias Mutants/Phenotypes Strains/Constructs	Ram AF, et al. (1994) A new approach for isolating cell wall mutants in Saccharomyces cerevisiae by screening for hypersensitivity to calcofluor white. Yeast 10(8):1019-30	|CAX4 |CWH41 |CWH43 |FKS1 |GAS1 |KRE6 |PTC1 |VMA9 |YCL007C
Mapping	Vincent A, et al. (1994) The yeast translational allosuppressor, SAL6: a new member of the PP1-like phosphatase family with a long serine-rich N-terminal extension. Genetics 138(3):597-608	|GLC7 |PPQ1 |PPZ1 |PPZ2 |SUP45 |TPK2
Function/Process Mutants/Phenotypes Regulatory Role	Fassler JS, et al. (1991) The Saccharomyces cerevisiae SPT14 gene is essential for normal expression of the yeast transposon, Ty, as well as for expression of the HIS4 gene and several genes in the mating pathway. Mol Gen Genet 230(1-2):310-20	|GAL11 |HIS4
Function/Process Mutants/Phenotypes Regulatory Role	Fassler JS and Winston F (1988) Isolation and analysis of a novel class of suppressor of Ty insertion mutations in Saccharomyces cerevisiae. Genetics 118(2):203-12	|GAL11 |HTA1 |HTB1 |SPT10 |SPT21 |SPT8

Return to SGD

Send a Message to the SGD Curators