PRM4/YPL156C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXVI: 256766 to 255912
CDS: 256766 - 255912

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM4 YPL156C ORF, Verified S000006077

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein proposed to be involved in mating; predicted to have 1 transmembrane segment; transcriptionally regulated by Ste12p during mating and by Cat8p during the diauxic shift

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
electron carrier activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002109
Assigned on 2008-10-13 UniProtKB
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
protein disulfide oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002109
Assigned on 2008-10-13 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
biological_process
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2009-09-25 SGD
cell redox homeostasis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002109
Assigned on 2008-10-13 UniProtKB
sexual reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9904
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM4/YPL156C for PRM4
1) Haurie V, et al. (2001) The transcriptional activator Cat8p provides a major contribution to the reprogramming of carbon metabolism during the diauxic shift in Saccharomyces cerevisiae. J Biol Chem 276(1):76-85

2) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

3) White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM4/YPL156C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM4/YPL156C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MIADSSV

C-term KDIPSNS

Length(aa) 284

MW(Da) 32,012

pI 6.7

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.069

Codon Adaptation Index 0.147

Frequency of Optimal Codons 0.448

Hydropathicity of Protein -0.373

Aromaticity Score 0.070

10 20 30 40 50 | | | | | MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADP SENKKNSEEESEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQS EVEVDIPEPSSKATSKFSSRSFQTDNVVTATTTTTLNPRSSSLALQKNCD HKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATV DLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVR DIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM4/YPL156C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM4 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Standard Name	Date Standardized	Reference
PRM4	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YPL156C SGD Systematic Sequence

855947 NCBI: Gene ID

NP_015169.1 NCBI: RefSeq protein version ID

NP_015169.1 NCBI: RefSeq protein version ID

6325101 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YPL156C	SGD Systematic Sequence
855947	NCBI: Gene ID
NP_015169.1	NCBI: RefSeq protein version ID
NP_015169.1	NCBI: RefSeq protein version ID
6325101	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically higher expression in carbon limited chemostat cultures versus carbon excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
14 curated references; 0 references not yet curated
Genomic expression study
RNA Levels and Processing
Del Vescovo V, et al. (2008) Role of Hog1 and Yaf9 in the transcriptional response of Saccharomyces cerevisiae to cesium chloride. Physiol Genomics 33(1):110-20
       |AGA1 |ALD3 |ARO10 |ATG1 |BRL1 |CAR2 |CMK2 |COX5B |CPR1 |CPR7 |CWP1 |CYC7 |DAN4 |DDR48 |MORE
Regulation of
Transcription
Hausmann A, et al. (2008) Cellular and Mitochondrial Remodeling upon Defects in Iron-Sulfur Protein Biogenesis. J Biol Chem 283(13):8318-30
       |ACO1 |AFT1 |AGP3 |ALD4 |ARN1 |ATM1 |BIO2 |BIO5 |CIT2 |COX4 |CTT1 |CYB5 |CYC1 |CYT2 |MORE
Protein Physical Properties
de Godoy LM, et al. (2008) Comprehensive mass-spectrometry-based proteome quantification of haploid versus diploid yeast. Nature 455(7217):1251-4
       |ACT1 |AFR1 |ASG7 |AXL1 |BAR1 |BEM1 |BNI1 |CDC24 |CDC28 |CDC42 |CLN1 |CLN2 |CLN3 |CTS1 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
RNA Levels and Processing
Zhang YQ and Rao R (2007) Global disruption of cell cycle progression and nutrient response by the antifungal agent amiodarone. J Biol Chem 282(52):37844-53
       |ACS1 |ALD4 |CAT8 |CNB1 |CRZ1 |CTA1 |CYB2 |CYR1 |DAL4 |DAL7 |DAL80 |ECI1 |FAA2 |FDH1 |MORE
DNA/RNA Sequence Features
Regulation of
Chou S, et al. (2006) Regulation of mating and filamentation genes by two distinct Ste12 complexes in Saccharomyces cerevisiae. Mol Cell Biol 26(13):4794-805
       |AFR1 |AGA1 |ASG7 |BAR1 |CHS7 |CIK1 |CLN1 |CWP1 |DDR48 |DIG1 |DIG2 |FIG1 |FUS1 |FUS2 |MORE
Protein-protein Interactions
Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60
         |ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Regulation of
Transcription
Daran-Lapujade P, et al. (2004) Role of transcriptional regulation in controlling fluxes in central carbon metabolism of Saccharomyces cerevisiae. A chemostat culture study. J Biol Chem 279(10):9125-38
           |AAD16 |ACH1 |ACO1 |ACO2 |ACS1 |ACS2 |ADH1 |ADH2 |ADH3 |ADH4 |ADH5 |AGP2 |AHP1 |ALD2 |MORE
Regulation of
Transcription
Mercier G, et al. (2004) Biological detection of low radiation doses by combining results of two microarray analysis methods. Nucleic Acids Res 32(1):e12
                   |AGP1 |AIM5 |ATO2 |ATP19 |ATP3 |BNA2 |COX4 |COX6 |CUP1-1 |CUP1-2 |CYT1 |FYV6 |GDH2 |IRA2 |MORE
Regulation of
Zeitlinger J, et al. (2003) Program-specific distribution of a transcription factor dependent on partner transcription factor and MAPK signaling. Cell 113(3):395-404
             |ACT1 |ADE1 |AFR1 |AGA1 |ASG7 |BEM1 |BEM2 |BMH1 |BUD14 |BUD8 |CHS1 |CHS7 |CIK1 |CLA4 |MORE
Regulation of
Transcription
Haurie V, et al. (2001) The transcriptional activator Cat8p provides a major contribution to the reprogramming of carbon metabolism during the diauxic shift in Saccharomyces cerevisiae. J Biol Chem 276(1):76-85
       |ACH1 |ACS1 |ADY2 |ALD6 |ATO2 |CAT2 |CAT8 |CUP1-1 |CUP1-2 |CWC23 |CWP1 |DAL81 |DLD1 |FBP1 |MORE
Reviews
White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20
       |PRM1 |PRM2 |PRM3 |PRM6 |VAM3 |VAM7
Function/Process
Protein Sequence Features
Regulation of
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM1 |PRM10 |PRM2 |PRM3 |PRM5 |PRM6 |PRM7 |PRM8 |PRM9
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Purnelle B, et al. (1996) The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators. Yeast 12(14):1483-92
     |ATG29 |BEM4 |CDC60 |KES1 |KIP2 |MLH3 |OYE3 |PEP4 |PET20 |PRP46 |PXA1 |PYK2 |RAD53 |REV3 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.