YDC1/YPL087W Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
YDC1 YPL087W   ORF, Verified S000006008
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1999-11-03. Gene name expires on 2000-11-03.
Description
Alkaline dihydroceramidase, involved in sphingolipid metabolism; preferentially hydrolyzes dihydroceramide to a free fatty acid and dihydrosphingosine; has a minor reverse activity

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
ceramidase activityMao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2002-11-01
SGD
hydrolase activityGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2007-05-23
UniProtKB
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidesDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR008901
Assigned on 2007-05-23
UniProtKB
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
ceramide biosynthetic processSchorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IGI : Inferred from Genetic Interaction with SGD:LAG1, SGD:LAC1
Assigned on 2010-02-02
SGD
ceramide metabolic processMao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IMP : Inferred from Mutant Phenotype
Assigned on 2002-11-01
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR008901
Assigned on 2007-05-23
UniProtKB
vacuolar protein catabolic processHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
Golgi apparatusGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14
UniProtKB
Golgi membraneDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR008901
Assigned on 2009-06-17
UniProtKB
endoplasmic reticulumMao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2002-11-01
SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23
UniProtKB
endoplasmic reticulum membraneDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR008901
Assigned on 2009-06-17
UniProtKB
integral to membraneDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR008901
Assigned on 2007-05-23
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23
UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01
UniProtKB
membraneGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23
UniProtKB

Pathways [TOP] [NEXT] Help
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT] Help
SUMMARY PARAGRAPH for YDC1/YPL087W for YDC1
About sphingolipid metabolism

Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(1). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (2). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (3, 4). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (5). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (6, 7).

Last Updated: 2007-10-05

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forYDC1/YPL087W for YDC1
1)Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
2)Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
3)Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
4)Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86
SGD Papers Entry  Pubmed Entry  
5)Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
6)Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
7)Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
8)Mao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for YDC1/YPL087W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for YDC1/YPL087W

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MLFSWPY
    C-term DETKKNN
    Length(aa) 317
    MW(Da) 37,231
    pI 7.15
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.110  
    Codon Adaptation Index 0.146  
    Frequency of Optimal Codons 0.479  
    Hydropathicity of Protein 0.402  
    Aromaticity Score 0.174  

                              10        20        30        40        50
                               |         |         |         |         |
                      MLFSWPYPEAPIEGYWGKPTSLIDWCEENYVVSPYIAEWSNTITNSIFLM
                      TAFYSTYSAWRNKLETRYILIGMGFSLVGIGSWLFHMTLQYRYQLLDELP
                      MLYATIIPSWSIFAETQEILIKDEKKRKESSFRIQMVISFIMCGIVTILT
                      WIYVVVQKPAIFQVLYGILTLLVVVLSGWLTYYHVHDSFAKKNLFITMVM
                      GMIPFVIGFICWQLDIHLCSFWIYIRRTYLALPLGVLLELHAWWHLLTGT
                      GVYIFVVYLQYLRILTHGNPNDFLFIWRWGFFPELVRKGLPIGTSYSLEY
                      LGPIVNTQVDDETKKNN*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to YDC1/YPL087W, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    No protein structure information available.

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameDate StandardizedReference
    YDC12001-02-07Mao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YPL087WSGD Systematic Sequence
    856018NCBI: Gene ID
    NP_015238.1NCBI: RefSeq protein version ID
    NP_015238.1NCBI: RefSeq protein version ID
    6325170NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    16 curated references; 0 references not yet curated
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Cerantola V, et al. (2009) Aureobasidin A arrests growth of yeast cells through both ceramide intoxication and deprivation of essential inositolphosphorylceramides. Mol Microbiol 71(6):1523-37
    SGD Papers Entry  Pubmed Entry  
    |AUR1 |LAC1 |LAG1 |YPC1
    RNA Levels and Processing
    Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Villa NY, et al. (2009) Sphingolipids function as downstream effectors of a fungal PAQR. Mol Pharmacol 75(4):866-75
    SGD Papers Entry  Pubmed Entry  SGD Curated Comments & Errata
    |FET3 |IZH2 |NRG1 |NRG2 |PKH1 |PKH2 |TPK2 |YPC1
    Regulation of
    Transcription
    Ye Y, et al. (2009) Gaining insight into the response logic of Saccharomyces cerevisiae to heat shock by combining expression profiles with metabolic pathways. Biochem Biophys Res Commun 385(3):357-62
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADH6 |ADH7 |AFT1 |ARA1 |ATH1 |CRD1 |DPL1 |FHL1 |GCY1 |GDB1 |GLC3 |GLG1 |GLG2 |GPH1 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Aerts AM, et al. (2008) Ydc1p ceramidase triggers organelle fragmentation, apoptosis and accelerated ageing in yeast. Cell Mol Life Sci 65(12):1933-42
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cross-species Expression
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Pata MO, et al. (2008) Molecular cloning and characterization of OsCDase, a ceramidase enzyme from rice. Plant J 55(6):1000-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |YPC1
    Mutants/Phenotypes
    Bishop AL, et al. (2007) Phenotypic heterogeneity can enhance rare-cell survival in 'stress-sensitive' yeast populations. Mol Microbiol 63(2):507-20
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADE12 |ADE2 |ADH5 |AGP2 |AIM10 |AIM7 |ARE2 |ATP1 |BUD5 |CBP6 |CCE1 |CCS1 |COX6 |CSE2 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Cerantola V, et al. (2007) Yeast sphingolipids do not need to contain very long chain fatty acids. Biochem J 401(1):205-216
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |LAC1 |LAG1 |LIP1 |YPC1
    Reviews
    Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |DPL1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR2 |TSC10 |TSC3 |YPC1 |YSR3
    Cross-species Expression
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Galadari S, et al. (2006) Identification of a novel amidase motif in neutral ceramidase. Biochem J 393(Pt 3):687-95
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |YPC1
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
    RNA Levels and Processing
    Regulation of
    Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Jiang JC, et al. (2004) Suppressor analysis points to the subtle role of the LAG1 ceramide synthase gene in determining yeast longevity. Exp Gerontol 39(7):999-1009
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |LAC1 |LAG1 |YPC1
    Reviews
    Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14
    SGD Papers Entry  Pubmed Entry  
    |ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |MORE
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Schorling S, et al. (2001) Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae. Mol Biol Cell 12(11):3417-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |LAC1 |LAG1 |YPC1
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Mao C, et al. (2000) Cloning and characterization of a Saccharomyces cerevisiae alkaline ceramidase with specificity for dihydroceramide. J Biol Chem 275(40):31369-78
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |YPC1


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.