---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ULP1/YPL020C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXVI: 514176 to 512311 CDS: 514176 - 512311 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ULP1	YPL020C	NIB1	ORF, Verified	S000005941
Description
Ubl (ubiquitin-like protein)-specific protease that cleaves Smt3p protein conjugates; specifically required for cell cycle progression; associates with nucleoporins and may interact with septin rings during telophase

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By SUMO-specific protease activity Li SJ and Hochstrasser M (1999) A new protease required for cell-cycle progression in yeast. Nature 398(6724):246-51        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2002-04-03 SGD cysteine-type peptidase activity Li SJ and Hochstrasser M (1999) A new protease required for cell-cycle progression in yeast. Nature 398(6724):246-51        IDA : Inferred from Direct Assay ISS : Inferred from Sequence or structural Similarity Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003653 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0788 Assigned on 2007-05-23 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB peptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0645 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By G2/M transition of mitotic cell cycle Li SJ and Hochstrasser M (1999) A new protease required for cell-cycle progression in yeast. Nature 398(6724):246-51        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT modification-dependent protein catabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0833 Assigned on 2009-03-04 UniProtKB protein desumoylation Li SJ and Hochstrasser M (1999) A new protease required for cell-cycle progression in yeast. Nature 398(6724):246-51        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2002-04-03 SGD proteolysis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003653 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By nuclear envelope Li SJ and Hochstrasser M (2000) The yeast ULP2 (SMT4) gene encodes a novel protease specific for the ubiquitin-like Smt3 protein. Mol Cell Biol 20(7):2367-77        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD nuclear pore Panse VG, et al. (2003) Unconventional tethering of Ulp1 to the transport channel of the nuclear pore complex by karyopherins. Nat Cell Biol 5(1):21-7        IDA : Inferred from Direct Assay Assigned on 2003-03-04 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forULP1/YPL020C for ULP1 1) Dobson MJ, et al. (2005) The 2 microm plasmid causes cell death in Saccharomyces cerevisiae with a mutation in Ulp1 protease. Mol Cell Biol 25(10):4299-310        2) Hochstrasser M (2001) SP-RING for SUMO: new functions bloom for a ubiquitin-like protein. Cell 107(1):5-8        3) Li SJ and Hochstrasser M (2003) The Ulp1 SUMO isopeptidase: distinct domains required for viability, nuclear envelope localization, and substrate specificity. J Cell Biol 160(7):1069-81        4) Soustelle C, et al. (2004) A new Saccharomyces cerevisiae strain with a mutant Smt3-deconjugating Ulp1 protein is affected in DNA replication and requires Srs2 and homologous recombination for its viability. Mol Cell Biol 24(12):5130-43

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ULP1/YPL020C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ULP1/YPL020C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSVEVDK C-term ILTDALK Length(aa) 621 MW(Da) 72,377 pI 10.27 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.040   Codon Adaptation Index 0.153   Frequency of Optimal Codons 0.438   Hydropathicity of Protein -0.927   Aromaticity Score 0.093

10 20 30 40 50 | | | | | MSVEVDKHRNTLQYHKKNPYSPLFSPISTYRCYPRVLNNPSESRRSASFS GIYKKRTNTSRFNYLNDRRVLSMEESMKDGSDRASKAGFIGGIRETLWNS GKYLWHTFVKNEPRNFDGSEVEASGNSDVESRSSGSRSSDVPYGLRENYS SDTRKHKFDTSTWALPNKRRRIESEGVGTPSTSPISSLASQKSNCDSDNS ITFSRDPFGWNKWKTSAIGSNSENNTSDQKNSYDRRQYGTAFIRKKKVAK QNINNTKLVSRAQSEEVTYLRQIFNGEYKVPKILKEERERQLKLMDMDKE KDTGLKKSIIDLTEKIKTILIENNKNRLQTRNENDDDLVFVKEKKISSLE RKHKDYLNQKLKFDRSILEFEKDFKRYNEILNERKKIQEDLKKKKEQLAK KKLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLN DTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDK LDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQK YVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFD YKDAIRMRRFIAHLILTDALK*

Protein Structures from PDB: proteins of known structure with sequence similarity to ULP1/YPL020C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to ULP1 Homolog Source (per PDB) Protein Alignment: ULP1 vs. Homolog External Links P-Value %Identical %Similar Alignment 2hl9 ( Chain: A) Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfonic acid PDB_Info PDB_Structure Saccharomyces cerevisiae 2.5e-85 100 0 View alignment SCOP MMDB CATH 2hl8 ( Chain: A) Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfinic acid PDB_Info PDB_Structure Saccharomyces cerevisiae 2.5e-85 100 0 View alignment SCOP MMDB CATH 2hkp ( Chain: A) Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfenic acid PDB_Info PDB_Structure Saccharomyces cerevisiae 2.5e-85 100 0 View alignment SCOP MMDB CATH 1euv ( Chain: A) X-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo. PDB_Info PDB_Structure Saccharomyces cerevisiae 2.5e-85 100 0 View alignment SCOP MMDB CATH 2iyd ( Chain: A) Senp1 covalent complex with sumo-2 PDB_Info PDB_Structure Homo sapiens 7.4e-18 30 36 View alignment SCOP MMDB CATH 2iyc ( Chain: A, B) Senp1 native structure PDB_Info PDB_Structure Homo sapiens Chain A = 7.4e-18 30 36 View alignment SCOP MMDB CATH Chain B = 7.4e-18 30 36 View alignment 2ckg ( Chain: A, B) The structure of senp1 sumo-2 co-complex suggests a structural basis for discrimination between sumo paralogues during processing PDB_Info PDB_Structure Homo sapiens Chain A = 1.2e-17 31 36 View alignment SCOP MMDB CATH Chain B = 1.2e-17 31 36 View alignment 2ckh ( Chain: A) Senp1-sumo2 complex PDB_Info PDB_Structure Homo sapiens 1.2e-17 31 36 View alignment SCOP MMDB CATH 2iy1 ( Chain: C, A) Senp1 (mutant) full length sumo1 PDB_Info PDB_Structure Homo sapiens Chain C = 5.7e-17 30 36 View alignment SCOP MMDB CATH Chain A = 5.7e-17 30 36 View alignment 2iy0 ( Chain: A) Senp1 (mutant) sumo1 rangap PDB_Info PDB_Structure Homo sapiens 5.7e-17 30 36 View alignment SCOP MMDB CATH 2g4d ( Chain: C, A) Crystal structure of human senp1 mutant (c603s) in complex with sumo-1 PDB_Info PDB_Structure Homo sapiens Chain C = 6.8e-16 33 32 View alignment SCOP MMDB CATH Chain A = 6.8e-16 33 32 View alignment 1th0 ( Chain: A, B) Structure of human senp2 PDB_Info PDB_Structure Homo sapiens Chain A = 2.5e-15 31 32 View alignment SCOP MMDB CATH Chain B = 2.5e-15 31 32 View alignment 1tgz ( Chain: A) Structure of human senp2 in complex with sumo-1 PDB_Info PDB_Structure Homo sapiens 2.5e-15 31 32 View alignment SCOP MMDB CATH 2io1 ( Chain: E, C, A) Crystal structure of human senp2 in complex with presumo-3 PDB_Info PDB_Structure Homo sapiens Chain E = 2.0e-14 30 32 View alignment SCOP MMDB CATH Chain C = 2.0e-14 30 32 View alignment Chain A = 2.0e-14 30 32 View alignment 2io0 ( Chain: A) Crystal structure of human senp2 in complex with presumo-2 PDB_Info PDB_Structure Homo sapiens 2.0e-14 30 32 View alignment SCOP MMDB CATH 2io3 ( Chain: A) Crystal structure of human senp2 in complex with rangap1- sumo-2 PDB_Info PDB_Structure Homo sapiens 2.0e-14 30 32 View alignment SCOP MMDB CATH 2io2 ( Chain: A) Crystal structure of human senp2 in complex with rangap1- sumo-1 PDB_Info PDB_Structure Homo sapiens 2.0e-14 30 32 View alignment SCOP MMDB CATH 2bkq ( Chain: C, B, D, A) Nedd8 protease PDB_Info PDB_Structure Homo sapiens Chain C = 0.003599 26 27 View alignment SCOP MMDB CATH Chain B = 0.003599 26 27 View alignment Chain D = 0.003599 26 27 View alignment Chain A = 0.003599 26 27 View alignment 2bkr ( Chain: A) Nedd8 nedp1 complex PDB_Info PDB_Structure Homo sapiens 0.003599 26 27 View alignment SCOP MMDB CATH 1xt9 ( Chain: A) Crystal structure of den1 in complex with nedd8 PDB_Info PDB_Structure Homo sapiens 0.008599 26 27 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ULP1	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
NIB1	Dobson MJ, et al. (2005) The 2 microm plasmid causes cell death in Saccharomyces cerevisiae with a mutation in Ulp1 protease. Mol Cell Biol 25(10):4299-310

Nomenclature History Notes

Date	Note
2006-03-20	The previously unmapped locus NIB1 was found to be allelic with ULP1/YPR020C, based on complementation experiments as described in Dobson et al. 2005. Dobson MJ, et al. (2005) The 2 microm plasmid causes cell death in Saccharomyces cerevisiae with a mutation in Ulp1 protease. Mol Cell Biol 25(10):4299-310

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YPL020C	SGD Systematic Sequence
856087	NCBI: Gene ID
NP_015305.1	NCBI: RefSeq protein version ID
NP_015305.1	NCBI: RefSeq protein version ID
6325237	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
56 curated references; 0 references not yet curated
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Industrial Applications Techniques and Reagents	Hughes SR, et al. (2009) Engineered Saccharomyces cerevisiae strain for improved xylose utilization with a three-plasmid SUMO yeast expression system. Plasmid 61(1):22-38
Reviews	Kim JH and Baek SH (2009) Emerging roles of desumoylating enzymes. Biochim Biophys Acta 1792(3):155-62	|SMT3 |ULP2
Strains/Constructs Techniques and Reagents	Kroetz MB and Hochstrasser M (2009) Identification of SUMO-interacting proteins by yeast two-hybrid analysis. Methods Mol Biol 497:107-20	|SMT3 |ULP2
Strains/Constructs Techniques and Reagents	Motejadded H and Altenbuchner J (2009) Construction of a dual-tag system for gene expression, protein affinity purification and fusion protein processing. Biotechnol Lett 31(4):543-9	|SMT3
Non-Fungal Related Genes/Proteins Protein Sequence Features Substrates/Ligands/Cofactors Techniques and Reagents	Reverter D and Lima CD (2009) Preparation of SUMO proteases and kinetic analysis using endogenous substrates. Methods Mol Biol 497:225-39	|SMT3 |ULP2
Reviews	Yeh ET (2009) SUMOylation and De-SUMOylation: Wrestling with Life's Processes. J Biol Chem 284(13):8223-7	|SMT3 |ULP2
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Function/Process Strains/Constructs Techniques and Reagents	Lee CD, et al. (2008) An improved SUMO fusion protein system for effective production of native proteins. Protein Sci 17(7):1241-8	|RAD51 |SMT3
Strains/Constructs	Leisner C, et al. (2008) Regulation of Mitotic Spindle Asymmetry by SUMO and the Spindle-Assembly Checkpoint in Yeast. Curr Biol 18(16):1249-55	|CBF2 |KAR9 |MAD2 |NFI1 |NNF1 |SIZ1 |SMT3 |UBC9
Function/Process Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Mullen JR and Brill SJ (2008) Activation of the Slx5-Slx8 Ubiquitin Ligase by Poly-small Ubiquitin-like Modifier Conjugates. J Biol Chem 283(29):19912-21	|NFI1 |PRE1 |PRE2 |SGS1 |SLX5 |SLX8 |SMT3 |SRS2
Function/Process Protein-protein Interactions Substrates/Ligands/Cofactors	Xu Z, et al. (2008) Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation. FASEB J 22(1):127-37	|SMT3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Burgess RC, et al. (2007) The Slx5-Slx8 complex affects sumoylation of DNA repair proteins and negatively regulates recombination. Mol Cell Biol 27(17):6153-62	|MMS21 |MRE11 |RAD1 |RAD50 |RAD51 |RAD52 |RAD54 |RAD57 |RAD59 |RFA1 |RFA2 |SLX5 |SLX8 |UBC9
Function/Process Genetic Interactions	Chen XL, et al. (2007) Topoisomerase I-Dependent Viability Loss in Saccharomyces cerevisiae Mutants Defective in Both SUMO Conjugation and DNA Repair. Genetics 177(1):17-30	|MRE11 |NFI1 |NUP133 |NUP60 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |RAD57 |SIZ1 |TOP1 |TRI1 |MORE
Mutants/Phenotypes Strains/Constructs	Huang RY, et al. (2007) Small ubiquitin-related modifier pathway is a major determinant of doxorubicin cytotoxicity in Saccharomyces cerevisiae. Cancer Res 67(2):765-72	|CDC11 |CDC3 |MLP1 |MMS21 |NFI1 |NUP60 |POL30 |RAD52 |RAD6 |SHS1 |SIZ1 |UBA2 |UBC9 |UIP3 |MORE
Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Strains/Constructs	Ihara M, et al. (2007) Noncovalent Binding of Small Ubiquitin-related Modifier (SUMO) Protease to SUMO Is Necessary for Enzymatic Activities and Cell Growth. J Biol Chem 282(22):16465-75	|SMT3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ii T, et al. (2007) Stimulation of in vitro sumoylation by Slx5-Slx8: evidence for a functional interaction with the SUMO pathway. DNA Repair (Amst) 6(11):1679-91	|NCB2 |SGS1 |SIZ1 |SLX5 |SLX8 |SMT3 |UBC9 |ULP2
Cellular Location Mutants/Phenotypes Protein Sequence Features Regulation of Strains/Constructs	Lewis A, et al. (2007) A nuclear envelope protein linking nuclear pore basket assembly, SUMO protease regulation, and mRNA surveillance. J Cell Biol 178(5):813-27	|ESC1 |ESC2 |MLP1 |MLP2 |NUP2 |NUP49 |NUP60 |SIR4 |ULP2 |YKU80
Cell Cycle Phase Involved Cellular Location Protein-protein Interactions Regulation of Strains/Constructs	Makhnevych T, et al. (2007) The role of karyopherins in the regulated sumoylation of septins. J Cell Biol 177(1):39-49	|CDC3 |KAP95 |MSN5 |NUP53 |PSE1 |SIZ1 |SRP1
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Palancade B, et al. (2007) Nucleoporins prevent DNA damage accumulation by modulating Ulp1-dependent sumoylation processes. Mol Biol Cell 18(8):2912-23	|MRE11 |NUP120 |NUP133 |NUP60 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |SLX5 |SLX8 |SRS2 |YKU70
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Reviews	Ulrich HD (2007) PCNA(SUMO) and Srs2: a model SUMO substrate-effector pair. Biochem Soc Trans 35(Pt 6):1385-8	|MMS21 |POL30 |RAD18 |RAD51 |RAD6 |SIZ1 |SMT3 |SRS2 |UBC9
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Xie Y, et al. (2007) The Yeast Hex3{middle dot}Slx8 Heterodimer Is a Ubiquitin Ligase Stimulated by Substrate Sumoylation. J Biol Chem 282(47):34176-84	|SLX5 |SLX8 |SMT3
Non-Fungal Related Genes/Proteins	Di Bacco A, et al. (2006) The SUMO-specific protease SENP5 is required for cell division. Mol Cell Biol 26(12):4489-98
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Panse VG, et al. (2006) Formation and nuclear export of preribosomes are functionally linked to the small-ubiquitin-related modifier pathway. Traffic 7(10):1311-21	|ARX1 |BUD20 |CIC1 |ECM1 |ENP1 |LSG1 |MEX67 |MTR2 |NOP14 |NOP7 |NSA1 |NUG1 |PWP2 |RIX1 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Genetic Interactions	Wang Z, et al. (2006) Genetic Analysis Connects SLX5 and SLX8 to the SUMO Pathway in Saccharomyces cerevisiae. Genetics 172(3):1499-509	|AOS1 |BUR6 |MOT1 |SLX5 |SLX8 |SMT3 |SPT15 |UBA2 |UBC9 |ULP2
Reviews	Aragon L (2005) Sumoylation: a new wrestler in the DNA repair ring. Proc Natl Acad Sci U S A 102(13):4661-2	|MLP1 |MLP2 |MMS21 |NFI1 |NSE1 |NSE3 |NSE4 |NSE5 |SIZ1 |SMC5 |SMC6 |YKU70
Alias Cellular Location Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Dobson MJ, et al. (2005) The 2 microm plasmid causes cell death in Saccharomyces cerevisiae with a mutation in Ulp1 protease. Mol Cell Biol 25(10):4299-310	|REP1 |REP2 |SMT3
Non-Fungal Related Genes/Proteins Techniques and Reagents	Li SJ, et al. (2005) Preparation and characterization of yeast and human desumoylating enzymes. Methods Enzymol 398:457-67	|ULP2
Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Wykoff DD and O'Shea EK (2005) Identification of sumoylated proteins by systematic immunoprecipitation of the budding yeast proteome. Mol Cell Proteomics 4(1):73-83	|CDC11 |GSY2 |NUT1 |RPS3 |RSC58 |RSC8 |SMT3 |SOD1 |TAF8 |TUP1 |YSH1
Non-Fungal Related Genes/Proteins	Yamaguchi T, et al. (2005) Mutation of SENP1/SuPr-2 reveals an essential role for desumoylation in mouse development. Mol Cell Biol 25(12):5171-82	|SMT3 |ULP2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zhao X and Blobel G (2005) A SUMO ligase is part of a nuclear multiprotein complex that affects DNA repair and chromosomal organization. Proc Natl Acad Sci U S A 102(13):4777-82	|KRE29 |MLP1 |MLP2 |MMS21 |NFI1 |NSE1 |NSE3 |NSE4 |NSE5 |SIZ1 |SMC5 |SMC6 |YKU70
Function/Process Substrates/Ligands/Cofactors Techniques and Reagents	Malakhov MP, et al. (2004) SUMO fusions and SUMO-specific protease for efficient expression and purification of proteins. J Struct Funct Genomics 5(1-2):75-86	|ULP2
Function/Process Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs	Soustelle C, et al. (2004) A new Saccharomyces cerevisiae strain with a mutant Smt3-deconjugating Ulp1 protein is affected in DNA replication and requires Srs2 and homologous recombination for its viability. Mol Cell Biol 24(12):5130-43	|RAD18 |RAD51 |RAD52 |SMT3 |SRS2
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Zhao X, et al. (2004) Mlp-dependent anchorage and stabilization of a desumoylating enzyme is required to prevent clonal lethality. J Cell Biol 167(4):605-11	|MLP1 |MLP2 |NUP60
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Li SJ and Hochstrasser M (2003) The Ulp1 SUMO isopeptidase: distinct domains required for viability, nuclear envelope localization, and substrate specificity. J Cell Biol 160(7):1069-81	|ULP2
Non-Fungal Related Genes/Proteins	Murtas G, et al. (2003) A nuclear protease required for flowering-time regulation in Arabidopsis reduces the abundance of SMALL UBIQUITIN-RELATED MODIFIER conjugates. Plant Cell 15(10):2308-19	|SMT3 |ULP2
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Panse VG, et al. (2003) Unconventional tethering of Ulp1 to the transport channel of the nuclear pore complex by karyopherins. Nat Cell Biol 5(1):21-7	|KAP95 |PSE1 |SRP1 |ULP2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Stead K, et al. (2003) Pds5p regulates the maintenance of sister chromatid cohesion and is sumoylated to promote the dissolution of cohesion. J Cell Biol 163(4):729-41	|ESP1 |MCD1 |NFI1 |PDS1 |PDS5 |SCC2 |SMC1 |SMC2 |SMC3 |SMT3 |TOP2 |ULP2
Non-Fungal Related Genes/Proteins	Bhaskar V, et al. (2002) Conjugation of Smt3 to dorsal may potentiate the Drosophila immune response. Mol Cell Biol 22(2):492-504	|SMT3
Function/Process Mutants/Phenotypes Strains/Constructs	Stade K, et al. (2002) A lack of SUMO conjugation affects cNLS-dependent nuclear protein import in yeast. J Biol Chem 277(51):49554-61	|CSE1 |KAP95 |NUP2 |RNA1 |SMT3 |SRM1 |SRP1 |UBA2 |ULP2
Reviews	Hochstrasser M (2001) SP-RING for SUMO: new functions bloom for a ubiquitin-like protein. Cell 107(1):5-8	|AOS1 |NFI1 |SIZ1 |SMT3 |UBA2 |ULP2
Mutants/Phenotypes	Stevenson LF, et al. (2001) A large-scale overexpression screen in Saccharomyces cerevisiae identifies previously uncharacterized cell cycle genes. Proc Natl Acad Sci U S A 98(7):3946-51	|ABF1 |ACS2 |ACT1 |ALO1 |ARF1 |ARF2 |BFA1 |BIM1 |BNI4 |CAJ1 |CCC1 |CDC14 |CDC20 |CDC55 |MORE
Fungal Related Genes/Proteins	Strunnikov AV, et al. (2001) Saccharomyces cerevisiae SMT4 encodes an evolutionarily conserved protease with a role in chromosome condensation regulation. Genetics 158(1):95-107	|NFI1 |SIZ1 |SMC2 |SMC4 |ULP2
Non-Fungal Related Genes/Proteins	Gong L, et al. (2000) Differential regulation of sentrinized proteins by a novel sentrin-specific protease. J Biol Chem 275(5):3355-9	|ULP2
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Regulation of Strains/Constructs	Li SJ and Hochstrasser M (2000) The yeast ULP2 (SMT4) gene encodes a novel protease specific for the ubiquitin-like Smt3 protein. Mol Cell Biol 20(7):2367-77	|SMT3 |UBC9 |ULP2
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Regulatory Role Strains/Constructs Substrates/Ligands/Cofactors	Mossessova E and Lima CD (2000) Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast. Mol Cell 5(5):865-76	|SMT3
Non-Fungal Related Genes/Proteins	Nishida T, et al. (2000) A novel mammalian Smt3-specific isopeptidase 1 (SMT3IP1) localized in the nucleolus at interphase. Eur J Biochem 267(21):6423-7	|SMT3
Non-Fungal Related Genes/Proteins	Pukatzki S, et al. (2000) A genetic interaction between a ubiquitin-like protein and ubiquitin-mediated proteolysis in Dictyostelium discoideum(1). Biochim Biophys Acta 1499(1-2):154-163	|DSK2 |ULP2
Cellular Location Fungal Related Genes/Proteins	Schwienhorst I, et al. (2000) SUMO conjugation and deconjugation. Mol Gen Genet 263(5):771-86	|AOS1 |SMT3 |UBA2 |ULP2
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs Techniques and Reagents	Takahashi Y, et al. (2000) Yeast Ulp1, an Smt3-specific protease, associates with nucleoporins. J Biochem 128(5):723-5	|CDC3 |GLE1 |NUP42 |SMT3 |SYN8 |UIP3 |UIP4 |UIP5
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Li SJ and Hochstrasser M (1999) A new protease required for cell-cycle progression in yeast. Nature 398(6724):246-51	|SMT3 |ULP2
Mutants/Phenotypes Strains/Constructs	Sweeney R and Zakian VA (1989) Extrachromosomal elements cause a reduced division potential in nib 1 strains of Saccharomyces cerevisiae. Genetics 122(4):749-57
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mapping Mutants/Phenotypes Strains/Constructs	Holm C (1982) Sensitivity to the Yeast Plasmid 2mu DNA is conferred by the nuclear allele nibl. Mol Cell Biol 2(8):985-92	|CEN16
Mapping	Wood JS (1982) Mitotic chromosome loss induced by methyl benzimidazole-2-yl-carbamate as a rapid mapping method in Saccharomyces cerevisiae. Mol Cell Biol 2(9):1080-7

Return to SGD

Send a Message to the SGD Curators