KRE5/YOR336W Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
  ChrXV: 949770 to 953867
CDS: 949770 - 953867Click on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| KRE5 | YOR336W |   | ORF, Verified | S000005863 | ||||
| Description | ||||||||
| Protein required for beta-1,6 glucan biosynthesis; mutations result in aberrant morphology and severe growth defects | ||||||||
| ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||
| ||||||||||||||||||||||
| ||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No pathways available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No summary paragraph available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for KRE5/YOR336W | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for KRE5/YOR336W | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MRLLALVLLLLCAPLRAWTYSLRYGIPESAQVWSILVHLLGDVDNQLLTN
LYPLVTGLDDEIDIQENLVALTSNVLRERYDKEDVADLLELYASLYPMGM
IQHDISSNAEQDDANSSYFVLNGNRYEKPDDVFYLKSKDLTIQQKVPDVD
VIQPYDVVIGTNSEAPILILYGCPTVIDSDFEEFNRNLFMEAMNGEGKFR
FIWRSTCSLDGKSVEYPLTHPLEITLQNGSRMSSIPQLKKILYTVPKEIL
VGADNDDQLHDLEPEELRELDLRVTSLISEFYQYKKDITATLNFTKSIVN
NFPLISKQLIKVSSVNKDIITSNEELNSKGFDYNMLGLYINGQNWKITSL
TPYNLLTALKTEYQSLLKITNLLQELEPSKCILDSKFLLNKFSQFSLGKL
QNLQPIKMDLHTIPGFSESVIYFNDIESDPQYDELVNSVQAFFDKSKFGE
LPEIKQNWSEIIFVIDFARLEDSEVKEALGGLVRAVNVVSQGYPQRVGLL
PFSSDSDKSVVNKIYELKNSTDNLTELKSFLETMLLADGLSANAKHSKHI
PVPDVFHLLDELQIDETSIIINGEIYPFRKNAWNYLIAKVIKKDTEFIRK
ELSNSSPKNKQISVRDLLHYKSANLRHNKYTPNYFADSVYSSVNNTALES
VCSERIGYYTKNEEYNLLHTITLVDDFGSIHALKRLRNLLHTSFVGVRIR
IIHVGDISDIWYQLRGSLSQKDPIGSINTFIDALKLKKVKSHTYKKSGLN
QLGLHKWLPDIPLFELQKGSFIALNGRFIHLDQNEVPETEHFEAIIKREA
LRTIDSVFALDLLFPGFSQEIINPDLIEMISSILTRLFYQGTHIYNNGID
YTTESSLPRMDLSEFFRPNNLTMFEDGKSASIDLLLILDPLEERTQMILS
LVEQFRPLKFVNIQVILMPTLELNIVPIRRIYVDDADIVKSITSEDSRSD
PEVDIEMDVPNSFIVDNNYRIKKLLIELHSFSSKTVLSTGNIDGMGGVCL
ALVDSAGNIIDKTTTMKTFGYGQFHTDKFLKGCYIKSCDSRYTVQSFSTD
GHPDFIPSDSLDILSYNPQKIAVKISEEPTHEEEYEEGRNNDTIINIFTI
LESGPDEEERYMQMILSILSKCPETQKVNFFILDQPFISDTLRKSCEYIN
SSDEMRGNVIFLNYEWPQWLRPQRFSSRRRDVSRFLFLDVLLPQNISKVL
YMSPTEVPLDPFDIFQFQGLKRAPLGLFRMSGDGYWKEGYWEKMLRENNL
EFYSTEPAFLVNLERFRELDAGDKYRIHYQRISTDAMSLVNIGQDLVNNL
QLEVPIRFLKGSYKKKLVINDECVSEWKKKINKFASSPGDEDVPGESVSS
KYQDSDNAAPLHDEL*
| ||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No protein structure information available. | |||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YOR336W | SGD Systematic Sequence |
| 854514 | NCBI: Gene ID |
| NP_014981.1 | NCBI: RefSeq protein version ID |
| NP_014981.1 | NCBI: RefSeq protein version ID |
| 6324912 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map |   | ||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 24 curated references; 0 references not yet curated | |||
| Mutants/Phenotypes Strains/Constructs | Aimanianda V, et al. (2009) Cell Wall {beta}-(1,6)-Glucan of Saccharomyces cerevisiae: STRUCTURAL CHARACTERIZATION AND IN SITU SYNTHESIS. J Biol Chem 284(20):13401-12 | |KRE6 |KRE9 | ||||
| Reviews | Joshi AS, et al. (2009) Cellular functions of cardiolipin in yeast. Biochim Biophys Acta 1793(1):212-8 | |COX4 |CRD1 |ISC1 |PGS1 |SLT2 |TAZ1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Zhou J, et al. (2009) Loss of cardiolipin leads to longevity defects that are alleviated by alterations in stress response signaling. J Biol Chem 284(27):18106-14 | |CRD1 |HSP12 |MSN2 |PBS2 |PGS1 |SHO1 |SSK2 |SSK22 |STE50 |YAP1 | ||||
| Mutants/Phenotypes Strains/Constructs | Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8 | |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE | ||||
| Genomic expression study RNA Levels and Processing | Del Vescovo V, et al. (2008) Role of Hog1 and Yaf9 in the transcriptional response of Saccharomyces cerevisiae to cesium chloride. Physiol Genomics 33(1):110-20 | |AGA1 |ALD3 |ARO10 |ATG1 |BRL1 |CAR2 |CMK2 |COX5B |CPR1 |CPR7 |CWP1 |CYC7 |DAN4 |DDR48 |MORE | ||||
| Cellular Location Protein Processing/Modification/Regulation Protein-protein Interactions Regulation of Strains/Constructs | Takeuchi M, et al. (2008) Saccharomyces cerevisiae Rot1 Is an Essential Molecular Chaperone in the Endoplasmic Reticulum. Mol Biol Cell 19(8):3514-25 | |DRS2 |GUP1 |KAR2 |KRE6 |ROT1 |UBC7 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Zhong Q, et al. (2007) Up-regulation of the cell integrity pathway in saccharomyces cerevisiae suppresses temperature sensitivity of the pgs1Delta mutant. J Biol Chem 282(22):15946-53 | |BCK1 |FKS1 |GSC2 |MKK1 |PGS1 |PKC1 |RHO1 |ROM2 |SLT2 | ||||
| Reviews | Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43 | |ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Zhong Q, et al. (2005) Loss of function of KRE5 suppresses temperature sensitivity of mutants lacking mitochondrial anionic lipids. Mol Biol Cell 16(2):665-75 | |PGS1 | ||||
| Cross-species Expression Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs | Herrero AB, et al. (2004) KRE5 gene null mutant strains of Candida albicans are avirulent and have altered cell wall composition and hypha formation properties. Eukaryot Cell 3(6):1423-32 | |||||
| Mutants/Phenotypes | Machi K, et al. (2004) Rot1p of Saccharomyces cerevisiae is a putative membrane protein required for normal levels of the cell wall 1,6-beta-glucan. Microbiology 150(Pt 10):3163-73 | |BIG1 |FLO1 |ROT1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Chavan M, et al. (2003) Genetic, biochemical, and morphological evidence for the involvement of N-glycosylation in biosynthesis of the cell wall beta1,6-glucan of Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 100(26):15381-6 | |KRE9 |STT3 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Azuma M, et al. (2002) Saccharomyces cerevisiae Big1p, a putative endoplasmic reticulum membrane protein required for normal levels of cell wall beta-1,6-glucan. Yeast 19(9):783-93 | |BIG1 | ||||
| Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Levinson JN, et al. (2002) Functional, comparative and cell biological analysis of Saccharomyces cerevisiae Kre5p. Yeast 19(14):1243-59 | |KRE6 | ||||
| DNA/RNA Sequence Features | Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6 | |AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE | ||||
| RNA Levels and Processing | Braley R and Chaffin WL (1999) Variations in mRNA transcript levels of cell wall-associated genes of Saccharomyces cerevisiae following spheroplasting. FEMS Microbiol Lett 181(1):177-85 | |CRH1 |EGT2 |EXO1 |FLO1 |HKR1 |KRE1 |KRE11 |MSN1 |MUC1 |PMT2 |SEC53 |SED1 |SKT5 |TIR1 | ||||
| Fungal Related Genes/Proteins Mutants/Phenotypes Other Features Strains/Constructs | Castro O, et al. (1999) Uridine diphosphate-glucose transport into the endoplasmic reticulum of Saccharomyces cerevisiae: in vivo and in vitro evidence. Mol Biol Cell 10(4):1019-30 | |ALG5 |ALG6 | ||||
| Cellular Location Function/Process | Montijn RC, et al. (1999) Localization of synthesis of beta1,6-glucan in Saccharomyces cerevisiae. J Bacteriol 181(24):7414-20 | |KRE6 |SEC1 |SKN1 | ||||
| Function/Process | Shahinian S, et al. (1998) Involvement of protein N-glycosyl chain glucosylation and processing in the biosynthesis of cell wall beta-1,6-glucan of Saccharomyces cerevisiae. Genetics 149(2):843-56 | |CNE1 |CWH41 | ||||
| DNA/RNA Sequence Features | Parle-McDermott AG, et al. (1996) Sequence of 29 kb around the PDR10 locus on the right arm of Saccharomyces cerevisiae chromosome XV: similarity to part of chromosome I. Yeast 12(10B Suppl):999-1004 | |ALA1 |FRT1 |FRT2 |FUN19 |MIP1 |MRS2 |MYO2 |PDR10 |PDR5 |SCD5 |SNC2 |TEA1 |VMA4 |YOR338W |MORE | ||||
| DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins | Yabe T, et al. (1996) HKR1 encodes a cell surface protein that regulates both cell wall beta-glucan synthesis and budding pattern in the yeast Saccharomyces cerevisiae. J Bacteriol 178(2):477-83 | |HKR1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Brown JL and Bussey H (1993) The yeast KRE9 gene encodes an O glycoprotein involved in cell surface beta-glucan assembly. Mol Cell Biol 13(10):6346-56 | |KRE1 |KRE11 |KRE6 |KRE9 |SKN1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Boone C, et al. (1990) Yeast KRE genes provide evidence for a pathway of cell wall beta-glucan assembly. J Cell Biol 110(5):1833-43 | |KRE1 |KRE6 | ||||
| Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs | Meaden P, et al. (1990) The yeast KRE5 gene encodes a probable endoplasmic reticulum protein required for (1----6)-beta-D-glucan synthesis and normal cell growth. Mol Cell Biol 10(6):3013-9 | |KRE6 | ||||
Return to SGD |