---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

DGK1/YOR311C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 899925 to 899053 CDS: 899925 - 899053 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
DGK1	YOR311C	HSD1	ORF, Verified	S000005838
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2001-02-07. Gene name expires on 2002-02-07.
Description
Diacylglycerol kinase, localized to the endoplasmic reticulum (ER); overproduction induces enlargement of ER-like membrane structures and suppresses a temperature-sensitive sly1 mutation; contains a CTP transferase domain

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By calcium ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0106 Assigned on 2009-03-04 UniProtKB diacylglycerol kinase activity Han GS, et al. (2008) Characterization of the Yeast DGK1-encoded CTP-dependent Diacylglycerol Kinase. J Biol Chem 283(29):20443-53        IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42        IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD kinase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0418 Assigned on 2009-03-04 UniProtKB magnesium ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0460 Assigned on 2009-03-04 UniProtKB phosphotransferase activity, alcohol group as acceptor GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.7.1 Assigned on 2009-03-04 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2009-03-04 UniProtKB transferase activity, transferring phosphorus-containing groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000374 Assigned on 2009-01-12 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By phosphatidic acid biosynthetic process Han GS, et al. (2008) Characterization of the Yeast DGK1-encoded CTP-dependent Diacylglycerol Kinase. J Biol Chem 283(29):20443-53        IDA : Inferred from Direct Assay Assigned on 2008-05-08 SGD Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42        IMP : Inferred from Mutant Phenotype Assigned on 2008-05-08 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0931 Assigned on 2008-02-14 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0333 Assigned on 2008-02-14 UniProtKB endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14      IDA : Inferred from Direct Assay Assigned on 2001-09-05 SGD integral to membrane Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14      ISS : Inferred from Sequence or structural Similarity Assigned on 2001-09-05 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000374 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-03-04 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forDGK1/YOR311C for DGK1 1) Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14      2) Han GS, et al. (2008) Characterization of the Yeast DGK1-encoded CTP-dependent Diacylglycerol Kinase. J Biol Chem 283(29):20443-53        3) Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for DGK1/YOR311C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for DGK1/YOR311C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MGTEDAI C-term VIKTFKK Length(aa) 290 MW(Da) 32,840 pI 9.48 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.037   Codon Adaptation Index 0.141   Frequency of Optimal Codons 0.430   Hydropathicity of Protein 0.206   Aromaticity Score 0.138	10 20 30 40 50 | | | | | MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDA HVPVTEIHLKSHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNV LWPLIYAFIILFILDLIRLNWPFFNMLYCRTVGALMRKKEIHTYNGVLWY ILGLIFSFNFFSKDVTLISLFLLSWSDTAAATIGRKYGHLTPKVARNKSL AGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPETSRLSLNMLSL LGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK*

Protein Structures from PDB: proteins of known structure with sequence similarity to DGK1/YOR311C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
DGK1	2001-09-05	Han GS, et al. (2008) Characterization of the Yeast DGK1-encoded CTP-dependent Diacylglycerol Kinase. J Biol Chem 283(29):20443-53        Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42

Alias Name(s)	Reference
HSD1	Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR311C	SGD Systematic Sequence
854488	NCBI: Gene ID
NP_014956.1	NCBI: RefSeq protein version ID
NP_014956.1	NCBI: RefSeq protein version ID
6324887	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
12 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Garbarino J, et al. (2009) Sterol and diacylglycerol acyltransferase deficiency triggers fatty acid-mediated cell death. J Biol Chem 284(45):30994-1005	|ARE1 |ARE2 |BFR1 |CHO2 |DGA1 |GET1 |GET2 |GET3 |ICE2 |LRO1 |OPI3 |RDL1 |SFB2 |TSC3
Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of Strains/Constructs	Huber A, et al. (2009) Characterization of the rapamycin-sensitive phosphoproteome reveals that Sch9 is a central coordinator of protein synthesis. Genes Dev 23(16):1929-43	|AMD1 |ATG13 |AVT1 |AVT4 |BUL1 |CCR4 |CTI6 |DED1 |DIG1 |DOT6 |DUR3 |ESC2 |FAR11 |GAL11 |MORE
Reviews	Mendonsa R and Engebrecht J (2009) Phospholipase D function in Saccharomyces cerevisiae. Biochim Biophys Acta 1791(9):970-4	|CSR1 |MSS4 |PAH1 |PDR16 |PDR17 |PIK1 |SEC14 |SFH5 |SMA1 |SNC1 |SPO14 |SPO20 |SSO1 |STE20 |MORE
Alias Genetic Interactions Strains/Constructs	Metzger MB and Michaelis S (2009) Analysis of quality control substrates in distinct cellular compartments reveals a unique role for Rpn4p in tolerating misfolded membrane proteins. Mol Biol Cell 20(3):1006-19	|ADE17 |ALF1 |CCT3 |CIK1 |ECM29 |GET3 |HAC1 |HRD1 |IDH1 |ITR1 |KAR2 |MAG1 |MIA40 |OTU1 |MORE
Reviews	Nohturfft A and Zhang SC (2009) Coordination of lipid metabolism in membrane biogenesis. Annu Rev Cell Dev Biol 25:539-66	|ECM22 |HAP1 |INO2 |INO4 |MOT3 |OPI1 |PAH1 |SCS2 |UPC2 |YER064C
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42	|CDS1 |CHO2 |GAT2 |NEM1 |OPI3 |PAH1 |PSD1 |SPO7
Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Han GS, et al. (2008) Characterization of the Yeast DGK1-encoded CTP-dependent Diacylglycerol Kinase. J Biol Chem 283(29):20443-53	|CDS1 |SEC59
Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Butcher RA, et al. (2006) Microarray-based method for monitoring yeast overexpression strains reveals small-molecule targets in TOR pathway. Nat Chem Biol 2(2):103-9	|BMH1 |BRE5 |BUD27 |BUD8 |CAJ1 |DCR2 |ELP2 |FET4 |FPR1 |FRE5 |FSP2 |GEP3 |GIC2 |GIS4 |MORE
Alias Fungal Related Genes/Proteins	Kim M, et al. (2002) A potential membrane protein involved in pre-tRNA splicing of Schizosaccharomyces pombe. Biochim Biophys Acta 1574(2):210-4
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Kosodo Y, et al. (2001) Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae. Yeast 18(11):1003-14	|BET1 |MID2 |SEC1 |SLG1 |SLY1 |SSB1 |SSB2 |SSD1 |USO1 |WSC2
Large-scale phenotype analysis Mutants/Phenotypes Strains/Constructs	Rieger KJ, et al. (1999) Chemotyping of yeast mutants using robotics. Yeast 15(10B):973-86	|ADY3 |AIM22 |AIM6 |AMA1 |AQR1 |AZR1 |BIT61 |CAF40 |CSH1 |CST26 |CUS2 |CYK3 |DLS1 |DTR1 |MORE
Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Pearson BM, et al. (1998) Construction of PCR-ligated long flanking homology cassettes for use in the functional analysis of six unknown open reading frames from the left and right arms of Saccharomyces cerevisiae chromosome XV. Yeast 14(4):391-9	|DUF1 |HSH49 |LDB19 |MPD2 |SPO21

Return to SGD

Send a Message to the SGD Curators