RAX1/YOR301W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXV: 880963 to 882270
CDS: 880963 - 882270

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

RAX1 YOR301W ORF, Verified S000005827

Description
Protein involved in bud site selection during bipolar budding; localization requires Rax2p; has similarity to members of the insulin-related peptide superfamily

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-09-30 SGD
signal transducer activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000342
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0132
Assigned on 2007-05-23 UniProtKB
cellular bud site selection Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8
       IGI : Inferred from Genetic Interaction
Assigned on 2002-09-30 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cellular bud neck Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9
       IDA : Inferred from Direct Assay
Assigned on 2004-07-12 SGD
Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57
       IDA : Inferred from Direct Assay
Assigned on 2004-12-09 SGD
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0029
Assigned on 2008-02-13 UniProtKB
cellular bud tip GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0030
Assigned on 2008-02-13 UniProtKB
integral to membrane Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2005-02-08 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
plasma membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-1003
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forRAX1/YOR301W for RAX1
1) Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9

2) Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for RAX1/YOR301W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for RAX1/YOR301W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MKEELSK

C-term CVPGRRV

Length(aa) 435

MW(Da) 50,160

pI 7.3

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.030

Codon Adaptation Index 0.094

Frequency of Optimal Codons 0.419

Hydropathicity of Protein -0.204

Aromaticity Score 0.103

10 20 30 40 50 | | | | | MKEELSKVSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFP YAINYLDFWVDLMTHTRLCKNYIELVRKSLINFPQEQQQNGSTSTATFDL LNALIEEGHLDPEAPDKLLENSGPDVPFSPKLNELLGDWKHQSGIGQEAL RNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQSER YLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSR VALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRIGF GLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVY SWFGVTQRLLHRHKNAGNDEGDASSDTDHVPMILAVFGGRRRLTRIEHPF TRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV*

Protein Structures from PDB: proteins of known structure with sequence similarity to RAX1/YOR301W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
RAX1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
RAX1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YOR301W SGD Systematic Sequence

854477 NCBI: Gene ID

NP_014945.1 NCBI: RefSeq protein version ID

NP_014945.1 NCBI: RefSeq protein version ID

6324876 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YOR301W	SGD Systematic Sequence
854477	NCBI: Gene ID
NP_014945.1	NCBI: RefSeq protein version ID
NP_014945.1	NCBI: RefSeq protein version ID
6324876	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
13 curated references; 0 references not yet curated
Reviews
Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384
       |AXL1 |AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |MORE
Fungal Related Genes/Proteins
Banuett F, et al. (2008) The machinery for cell polarity, cell morphogenesis, and the cytoskeleton in the Basidiomycete fungus Ustilago maydis-a survey of the genome sequence. Fungal Genet Biol 45 Suppl 1:S3-S14
       |ABP1 |ACT1 |ARP1 |ARP10 |ARP2 |ARP3 |AXL2 |BEM1 |BIK1 |BIM1 |BNI1 |BUD6 |CDC10 |CDC11 |MORE
Protein-protein Interactions
Krappmann AB, et al. (2007) Distinct domains of yeast cortical tag proteins bud8p and bud9p confer polar localization and functionality. Mol Biol Cell 18(9):3323-39
       |BUD5 |BUD8 |BUD9
Reviews
Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96
       |ACT1 |AXL1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC10 |MORE
Cell Cycle Phase Involved
Transcription
Rowicka M, et al. (2007) High-resolution timing of cell cycle-regulated gene expression. Proc Natl Acad Sci U S A 104(43):16892-7
           |BNI4 |BUD13 |CDC11 |CDC12 |CDC28 |CDC3 |CLB1 |CLN2 |CLN3 |FKS1 |GAS1 |GAS5 |GIC2 |HHF2 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Chasse SA, et al. (2006) Genome-scale analysis reveals Sst2 as the principal regulator of mating pheromone signaling in the yeast Saccharomyces cerevisiae. Eukaryot Cell 5(2):330-46
         |ASC1 |BAR1 |CLA4 |FUS3 |GAS1 |GPA1 |GPA2 |HOG1 |KSS1 |MDM1 |PBS2 |RGS2 |SIR2 |SIR3 |MORE
Regulation of
Transcription
Purevdorj-Gage B, et al. (2006) Effects of low-shear modeled microgravity on cell function, gene expression, and phenotype in Saccharomyces cerevisiae. Appl Environ Microbiol 72(7):4569-75
       |BUD25 |BUD5 |DSE1 |DSE2 |DSE4 |EGT2 |RAX2
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Transcription
Slattery MG, et al. (2006) The function and properties of the Azf1 transcriptional regulator change with growth conditions in Saccharomyces cerevisiae. Eukaryot Cell 5(2):313-20
           |ADK2 |ADY3 |AIM20 |ANS1 |AQR1 |ARI1 |AZF1 |CIS3 |CLN1 |CLN3 |CPA1 |CRF1 |CSI2 |CYS3 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Physical Properties
Protein Sequence Features
Regulation of
Regulatory Role
Strains/Constructs
Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9
       |AXL1 |AXL2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Protein-protein Interactions
Strains/Constructs
Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57
       |BUD8 |BUD9 |RAX2
Function/Process
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8
       |RAX2
Mutants/Phenotypes
Strains/Constructs
Lafuente MJ and Gancedo C (1999) Disruption and basic functional analysis of six novel ORFs of chromosome XV from Saccharomyces cerevisiae. Yeast 15(10B):935-43
       |HPF1 |MCH4 |MCH5 |YIL169C |YOL118C |ZPS1
DNA/RNA Sequence Features
Mapping
Poirey R, et al. (1997) Sequence and analysis of a 36.2 kb fragment from the right arm of yeast chromosome XV reveals 19 open reading frames including SNF2 (5' end), CPA1, SLY41, a putative transport ATPase, a putative ribosomal protein and an SNF2 homologue. Yeast 13(5):479-82
       |BUD7 |CPA1 |ISW2 |MCH5 |MUM3 |RPS10A |RRG7 |RRS1 |SLY41 |SNF2 |SNU66 |TIM18 |UAF30 |YOR292C |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.