BUD7/YOR299W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXV: 878433 to 880673
CDS: 878433 - 880673

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD7 YOR299W ORF, Verified S000005825

Description
Member of the ChAPs family of proteins (Chs5p-Arf1p-binding proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms the exomer complex with Chs5p to mediate export of specific cargo proteins, including Chs3p, from the Golgi to the plasma membrane

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-10-01 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
Golgi to plasma membrane transport Trautwein M, et al. (2006) Arf1p, Chs5p and the ChAPs are required for export of specialized cargo from the Golgi. EMBO J 25(5):943-54
       IGI : Inferred from Genetic Interaction with SGD:BCH1
Assigned on 2006-05-31 SGD
cell wall chitin biosynthetic process Trautwein M, et al. (2006) Arf1p, Chs5p and the ChAPs are required for export of specialized cargo from the Golgi. EMBO J 25(5):943-54
       IPI : Inferred from Physical Interaction with SGD:CHS3
IGI : Inferred from Genetic Interaction
Assigned on 2006-06-09 SGD
cellular bud site selection Zahner JE, et al. (1996) Genetic analysis of the bipolar pattern of bud site selection in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(4):1857-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-26 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2009-06-29 UniProtKB
colocalizes_with clathrin-coated vesicle Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         IDA : Inferred from Direct Assay
Assigned on 2003-10-28 SGD
exomer complex Wang CW, et al. (2006) Exomer: A coat complex for transport of select membrane proteins from the trans-Golgi network to the plasma membrane in yeast. J Cell Biol 174(7):973-83
         IDA : Inferred from Direct Assay
Assigned on 2007-12-14 SGD
extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9903
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
colocalizes_with trans-Golgi network transport vesicle Trautwein M, et al. (2006) Arf1p, Chs5p and the ChAPs are required for export of specialized cargo from the Golgi. EMBO J 25(5):943-54
       IDA : Inferred from Direct Assay
Assigned on 2006-05-31 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD7/YOR299W for BUD7
1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

2) Trautwein M, et al. (2006) Arf1p, Chs5p and the ChAPs are required for export of specialized cargo from the Golgi. EMBO J 25(5):943-54

3) Wang CW, et al. (2006) Exomer: A coat complex for transport of select membrane proteins from the trans-Golgi network to the plasma membrane in yeast. J Cell Biol 174(7):973-83

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD7/YOR299W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD7/YOR299W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MITQNSI

C-term TIGCYDA

Length(aa) 746

MW(Da) 84,829

pI 4.89

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.028

Codon Adaptation Index 0.110

Frequency of Optimal Codons 0.427

Hydropathicity of Protein -0.165

Aromaticity Score 0.087

10 20 30 40 50 | | | | | MITQNSIPEVKEDFIGYALHERRIRLPQFQDLGPADLVTLTKYLPTSSNT NAINSTSRNGAAIIQSPAAVVADDSAASMATNGDASDTAVTTNYTNASIY SSSRNANDGAPMVAELHPLDKLKDEVGTFFYSMGVDTSGPTSIAIFLKEI SEVISEKPQVWFGRKKTFNVARISFSTWNAFRRCDINVVVHIPGSIQNFI VDCNGESQNIEMCADYDLIWAETFVSGVVRSIMLMKENAEEGELQNLVET LILNPFTAGQIDDVPEMFIDLFPIVYHKGPLLGAPYYITNVTNTNNYLVE TLVEIVKLTRNVSRAEIMLKNLATDNPEAIIILIKIFLVCDQELDAIKLT YDMLSQDKIINNTNNRMDYKSELLCLQAQFLIDKRQDYSLAQNIAQEAVN CSPSEFRPWYLLSKVYVKLNDIENALLILNSCPMSPLKEKYVLKRVAPLP SNNSLHLPLPIDVVLDEVTSLNPQDVQNEHRSADPMLVNLAASNLKSTFQ LAYRLLTEIVQITGWENLLKYRSNIFVMEEEYQKSSSSLPKDVNKQEEQP LRAKRLCERWLDNLFMLLYEDLKMYTLWQTEQLYMDAQNNNHNKLTFEWE LFGLCARRLGHFPEAAKAFQNGLSQRFSSRCARKLLEYCINERQRVKNFI NSPNSHDMVPEIVSSRIRELDNSIIDLCVKICCWNHRWYTEFSISLLDCL SVVIQDMSLTKVSNEISSRYPETVLNLVQENLLNFFTTCTIGCYDA*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD7/YOR299W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
BUD7 SGD (2007) Information without a citation in SGD

Standard Name	Reference
BUD7	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YOR299W SGD Systematic Sequence

854475 NCBI: Gene ID

NP_014943.1 NCBI: RefSeq protein version ID

NP_014943.1 NCBI: RefSeq protein version ID

6324874 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YOR299W	SGD Systematic Sequence
854475	NCBI: Gene ID
NP_014943.1	NCBI: RefSeq protein version ID
NP_014943.1	NCBI: RefSeq protein version ID
6324874	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
12 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Barfield RM, et al. (2009) The exomer coat complex transports Fus1p to the plasma membrane via a novel plasma membrane sorting signal in yeast. Mol Biol Cell 20(23):4985-96
       |APL2 |BCH1 |BCH2 |CHS5 |CHS6 |FUS1
Regulation of
Transcription
Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
       |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
DNA/RNA Sequence Features
Ferreira TC, et al. (2007) The yeast genome may harbor hypoxia response elements (HRE). Comp Biochem Physiol C Toxicol Pharmacol 146(1-2):255-63
       |AFT1 |ALD6 |ARO9 |ASC1 |ATM1 |CIS3 |CTF19 |CWP1 |DAN1 |EXG1 |GIT1 |GLY1 |GPA2 |GSH1 |MORE
Mutants/Phenotypes
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Sanchatjate S and Schekman R (2006) Chs5/6 complex: a multiprotein complex that interacts with and conveys chitin synthase III from the trans-Golgi network to the cell surface. Mol Biol Cell 17(10):4157-66
       |APL2 |ARF1 |BCH1 |BCH2 |CHS3 |CHS5 |CHS6 |TLG1
Cellular Location
Evolution
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Trautwein M, et al. (2006) Arf1p, Chs5p and the ChAPs are required for export of specialized cargo from the Golgi. EMBO J 25(5):943-54
       |ARF1 |BCH1 |BCH2 |CHS3 |CHS5 |CHS6
Function/Process
Protein-protein Interactions
Wang CW, et al. (2006) Exomer: A coat complex for transport of select membrane proteins from the trans-Golgi network to the plasma membrane in yeast. J Cell Biol 174(7):973-83
         |ARF1 |BCH1 |BCH2 |CHS5 |CHS6 |PIK1 |SEC7
Genomic expression study
RNA Levels and Processing
Regulation of
Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55
               |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |CAR2 |MORE
Cellular Location
Strains/Constructs
Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
         |AAH1 |AAP1 |ABZ1 |ABZ2 |ACB1 |ACO2 |ADD37 |ADD66 |ADE1 |ADE12 |ADE2 |ADE3 |ADE4 |ADE6 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |MORE
DNA/RNA Sequence Features
Mapping
Poirey R, et al. (1997) Sequence and analysis of a 36.2 kb fragment from the right arm of yeast chromosome XV reveals 19 open reading frames including SNF2 (5' end), CPA1, SLY41, a putative transport ATPase, a putative ribosomal protein and an SNF2 homologue. Yeast 13(5):479-82
       |CPA1 |ISW2 |MCH5 |MUM3 |RAX1 |RPS10A |RRG7 |RRS1 |SLY41 |SNF2 |SNU66 |TIM18 |UAF30 |YOR292C |MORE
Mutants/Phenotypes
Zahner JE, et al. (1996) Genetic analysis of the bipolar pattern of bud site selection in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(4):1857-70
       |BNI1 |BUD2 |BUD5 |BUD6 |BUD8 |BUD9 |CDC12 |SPA2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.