---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CDC31/YOR257W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 811008 to 811493 CDS: 811008 - 811493 Genetic position: 147 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CDC31	YOR257W	DSK1	ORF, Verified	S000005783
Description
Calcium-binding component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; binds multiubiquitinated proteins and is involved in proteasomal protein degradation

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By calcium ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002048 , EBI:IPR011992 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0106 Assigned on 2007-05-23 UniProtKB Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc structural constituent of cytoskeleton Winsor B and Schiebel E (1997) Review: an overview of the Saccharomyces cerevisiae microtubule and microfilament cytoskeleton. Yeast 13(5):399-434        IPI : Inferred from Physical Interaction Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0132 Assigned on 2007-05-23 UniProtKB mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB microtubule nucleation Winsor B and Schiebel E (1997) Review: an overview of the Saccharomyces cerevisiae microtubule and microfilament cytoskeleton. Yeast 13(5):399-434        IPI : Inferred from Physical Interaction Assigned on 2001-01-18 SGD microtubule organizing center organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mitosis GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0498 Assigned on 2007-05-23 UniProtKB proteasomal ubiquitin-dependent protein catabolic process Chen L and Madura K (2008) Centrin/Cdc31 is a novel regulator of protein degradation. Mol Cell Biol 28(5):1829-40        IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2008-04-11 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB spindle pole body duplication in nuclear envelope Winsor B and Schiebel E (1997) Review: an overview of the Saccharomyces cerevisiae microtubule and microfilament cytoskeleton. Yeast 13(5):399-434        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2009-11-20 UniProtKB cytoskeleton GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0206 Assigned on 2009-11-20 UniProtKB half bridge of spindle pole body Spang A, et al. (1993) The calcium-binding protein cell division cycle 31 of Saccharomyces cerevisiae is a component of the half bridge of the spindle pole body. J Cell Biol 123(2):405-16      IDA : Inferred from Direct Assay Assigned on 2007-07-16 SGD nuclear pore Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75        TAS : Traceable Author Statement Assigned on 2002-03-13 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB colocalizes_with nucleotide-excision repair factor 2 complex Chen L and Madura K (2008) Centrin/Cdc31 is a novel regulator of protein degradation. Mol Cell Biol 28(5):1829-40        IPI : Inferred from Physical Interaction with SGD:RAD4 Assigned on 2008-04-11 SGD nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB spindle pole body GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0252 Assigned on 2009-05-06 UniProtKB transcription export complex 2 Fischer T, et al. (2004) Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery. Nat Cell Biol 6(9):840-8        IDA : Inferred from Direct Assay Assigned on 2009-04-16 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forCDC31/YOR257W for CDC31 1) Spang A, et al. (1993) The calcium-binding protein cell division cycle 31 of Saccharomyces cerevisiae is a component of the half bridge of the spindle pole body. J Cell Biol 123(2):405-16      2) Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        3) Chen L and Madura K (2008) Centrin/Cdc31 is a novel regulator of protein degradation. Mol Cell Biol 28(5):1829-40        4) Hartwell LH, et al. (1970) Genetic control of the cell-division cycle in yeast. I. Detection of mutants. Proc Natl Acad Sci U S A 66(2):352-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CDC31/YOR257W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CDC31/YOR257W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSKNRSS C-term IAICTDS Length(aa) 161 MW(Da) 18,751 pI 4.26 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.076   Codon Adaptation Index 0.108   Frequency of Optimal Codons 0.368   Hydropathicity of Protein -0.609   Aromaticity Score 0.087	10 20 30 40 50 | | | | | MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMK ALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKR AFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEIN ENEFIAICTDS*

Protein Structures from PDB: proteins of known structure with sequence similarity to CDC31/YOR257W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to CDC31 Homolog Source (per PDB) Protein Alignment: CDC31 vs. Homolog External Links P-Value %Identical %Similar Alignment 3fwc ( Chain: E, I, A, M) Sac3:sus1:cdc31 complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain E = 4.2e-62 100 0 View alignment SCOP MMDB CATH Chain I = 4.2e-62 100 0 View alignment Chain A = 4.2e-62 100 0 View alignment Chain M = 4.2e-62 100 0 View alignment 2gv5 ( Chain: B, D, A, E) Crystal structure of sfi1p/cdc31p complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain B = 4.2e-62 100 0 View alignment SCOP MMDB CATH Chain D = 4.2e-62 100 0 View alignment Chain A = 4.2e-62 100 0 View alignment Chain E = 4.2e-62 100 0 View alignment 2doq ( Chain: B, A, C) Crystal structure of sfi1p/cdc31p complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain B = 4.2e-62 100 0 View alignment SCOP MMDB CATH Chain A = 4.2e-62 100 0 View alignment Chain C = 4.2e-62 100 0 View alignment 3fwb ( Chain: A) Sac3:sus1:cdc31 complex PDB_Info PDB_Structure Saccharomyces cerevisiae 4.2e-62 100 0 View alignment SCOP MMDB CATH 2ggm ( Chain: A, B) Human centrin 2 xeroderma pigmentosum group c protein complex PDB_Info PDB_Structure Homo sapiens Chain A = 1.2e-29 58 22 View alignment SCOP MMDB CATH Chain B = 1.2e-29 58 22 View alignment 2obh ( Chain: B, A) Centrin-xpc peptide PDB_Info PDB_Structure Homo sapiens Chain B = 9.9e-29 61 21 View alignment SCOP MMDB CATH Chain A = 9.9e-29 61 21 View alignment 1xfv ( Chain: O, Q, P, T, S, R) Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3' deoxy-atp PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain O = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain Q = 2.9e-19 42 29 View alignment Chain P = 2.9e-19 42 29 View alignment Chain T = 2.9e-19 42 29 View alignment Chain S = 2.9e-19 42 29 View alignment Chain R = 2.9e-19 42 29 View alignment 1xfz ( Chain: Q, T, R, S, P, O) Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 1 millimolar exogenously added calcium chloride PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain Q = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain T = 2.9e-19 42 29 View alignment Chain R = 2.9e-19 42 29 View alignment Chain S = 2.9e-19 42 29 View alignment Chain P = 2.9e-19 42 29 View alignment Chain O = 2.9e-19 42 29 View alignment 1xfx ( Chain: P, R, T, S, Q, O) Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain P = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain R = 2.9e-19 42 29 View alignment Chain T = 2.9e-19 42 29 View alignment Chain S = 2.9e-19 42 29 View alignment Chain Q = 2.9e-19 42 29 View alignment Chain O = 2.9e-19 42 29 View alignment 1xfu ( Chain: R, T, S, Q, P, O) Crystal structure of anthrax edema factor (ef) truncation mutant, ef-delta 64 in complex with calmodulin PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain R = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain T = 2.9e-19 42 29 View alignment Chain S = 2.9e-19 42 29 View alignment Chain Q = 2.9e-19 42 29 View alignment Chain P = 2.9e-19 42 29 View alignment Chain O = 2.9e-19 42 29 View alignment 1xfy ( Chain: T, S, Q, R, P, O) Crystal structure of anthrax edema factor (ef) in complex with calmodulin PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain T = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain S = 2.9e-19 42 29 View alignment Chain Q = 2.9e-19 42 29 View alignment Chain R = 2.9e-19 42 29 View alignment Chain P = 2.9e-19 42 29 View alignment Chain O = 2.9e-19 42 29 View alignment 1xfw ( Chain: T, Q, P, S, R, O) Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3'5' cyclic amp (camp) PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain T = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain Q = 2.9e-19 42 29 View alignment Chain P = 2.9e-19 42 29 View alignment Chain S = 2.9e-19 42 29 View alignment Chain R = 2.9e-19 42 29 View alignment Chain O = 2.9e-19 42 29 View alignment 1wrz ( Chain: A) Calmodulin complexed with a peptide from a human death- associated protein kinase PDB_Info PDB_Structure Homo sapiens 2.9e-19 42 29 View alignment SCOP MMDB CATH 1lvc ( Chain: D, E, F) Crystal structure of the adenylyl cyclase domain of anthrax edema factor (ef) in complex with calmodulin and 2' deoxy, 3' anthraniloyl atp PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain D = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain E = 2.9e-19 42 29 View alignment Chain F = 2.9e-19 42 29 View alignment 3hr4 ( Chain: H, B, F, D) Calmodulin PDB_Info PDB_Structure Unknown Chain H = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain B = 2.9e-19 42 29 View alignment Chain F = 2.9e-19 42 29 View alignment Chain D = 2.9e-19 42 29 View alignment 2r28 ( Chain: B, A) The complex structure of calmodulin bound to a calcineurin peptide PDB_Info PDB_Structure Homo sapiens Chain B = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain A = 2.9e-19 42 29 View alignment 2w73 ( Chain: E, B, F, A) CALMODULIN PDB_Info PDB_Structure Unknown Chain E = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain B = 2.9e-19 42 29 View alignment Chain F = 2.9e-19 42 29 View alignment Chain A = 2.9e-19 42 29 View alignment 2v01 ( Chain: A) Recombinant vertebrate calmodulin complexed with pb PDB_Info PDB_Structure Homo sapiens 2.9e-19 42 29 View alignment SCOP MMDB CATH 1iq5 ( Chain: A) Calmodulin/nematode ca2+/calmodulin dependent kinase kinase fragment PDB_Info PDB_Structure Xenopus laevis 2.9e-19 42 29 View alignment SCOP MMDB CATH 2v02 ( Chain: A) Recombinant vertebrate calmodulin complexed with ba PDB_Info PDB_Structure Homo sapiens 2.9e-19 42 29 View alignment SCOP MMDB CATH 2bki ( Chain: B, D) Myosin vi nucleotide-free (mdinsert2-iq) crystal structure PDB_Info PDB_Structure Sus scrofa | Gallus gallus Chain B = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain D = 2.9e-19 42 29 View alignment 2be6 ( Chain: C, B, A) .0 a crystal structure of the cav1.2 iq domain-ca/cam complex PDB_Info PDB_Structure Homo sapiens Chain C = 2.9e-19 42 29 View alignment SCOP MMDB CATH Chain B = 2.9e-19 42 29 View alignment Chain A = 2.9e-19 42 29 View alignment 1zuz ( Chain: A) Calmodulin in complex with a mutant peptide from human drp- 1 kinase PDB_Info PDB_Structure Homo sapiens 2.9e-19 42 29 View alignment SCOP MMDB CATH 2wel ( Chain: D) Crystal structure of su6656-bound calcium/calmodulin- dependent protein kinase ii delta in complex with calmodulin PDB_Info PDB_Structure Homo sapiens 2.9e-19 42 29 View alignment SCOP MMDB CATH 2vb6 ( Chain: B) Myosin vi (md-insert2-cam, delta insert1) post-rigor state ( crystal form 2) PDB_Info PDB_Structure Sus scrofa | Gallus gallus 3.4e-19 42 30 View alignment SCOP MMDB CATH 2vas ( Chain: B) Myosin vi (md-insert2-cam, delta-insert1) post-rigor state PDB_Info PDB_Structure Sus scrofa | Drosophila melanogaster 3.4e-19 42 30 View alignment SCOP MMDB CATH 3gn4 ( Chain: H, F, D, B) Calmodulin PDB_Info PDB_Structure Unknown Chain H = 3.4e-19 42 30 View alignment SCOP MMDB CATH Chain F = 3.4e-19 42 30 View alignment Chain D = 3.4e-19 42 30 View alignment Chain B = 3.4e-19 42 30 View alignment 1ooj ( Chain: A) Structural genomics of caenorhabditis elegans : calmodulin PDB_Info PDB_Structure Caenorhabditis elegans 3.4e-19 42 30 View alignment SCOP MMDB CATH 2bkh ( Chain: B) Myosin vi nucleotide-free (mdinsert2) crystal structure PDB_Info PDB_Structure Sus scrofa | Drosophila melanogaster 3.4e-19 42 30 View alignment SCOP MMDB CATH 2f2o ( Chain: A, B) Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode PDB_Info PDB_Structure Bos taurus Chain A = 3.6e-19 42 29 View alignment SCOP MMDB CATH Chain B = 3.6e-19 42 29 View alignment 2f2p ( Chain: B, A) Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode PDB_Info PDB_Structure Bos taurus Chain B = 3.6e-19 42 29 View alignment SCOP MMDB CATH Chain A = 3.6e-19 42 29 View alignment 2ix7 ( Chain: B, A) Structure of apo-calmodulin bound to unconventional myosin v PDB_Info PDB_Structure Mus musculus Chain B = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain A = 3.9e-19 43 29 View alignment 2vay ( Chain: A) Calmodulin complexed with cav1.1 iq peptide PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1cfd ( Chain: A) Calcium-free calmodulin PDB_Info PDB_Structure Xenopus laevis 3.9e-19 43 29 View alignment SCOP MMDB CATH 1qiw ( Chain: B, A) Calmodulin complexed with n-(3,3,-diphenylpropyl)-n'-[1-r-( 3,4-bis-butoxyphenyl)-ethyl]-propylenediamine (dpd) PDB_Info PDB_Structure Bos taurus Chain B = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain A = 3.9e-19 43 29 View alignment 1xa5 ( Chain: A) Structure of calmodulin in complex with kar-2, a bis-indol alkaloid PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2o60 ( Chain: A) Calmodulin bound to peptide from neuronal nitric oxide synthase PDB_Info PDB_Structure Gallus gallus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2dfs ( Chain: Q, E, B, N, G, F, O, D, R, C, S, P) -d structure of myosin-v inhibited state PDB_Info PDB_Structure Gallus gallus | Mus musculus Chain Q = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain E = 3.9e-19 43 29 View alignment Chain B = 3.9e-19 43 29 View alignment Chain N = 3.9e-19 43 29 View alignment Chain G = 3.9e-19 43 29 View alignment Chain F = 3.9e-19 43 29 View alignment Chain O = 3.9e-19 43 29 View alignment Chain D = 3.9e-19 43 29 View alignment Chain R = 3.9e-19 43 29 View alignment Chain C = 3.9e-19 43 29 View alignment Chain S = 3.9e-19 43 29 View alignment Chain P = 3.9e-19 43 29 View alignment 2k0e ( Chain: A) A coupled equilibrium shift mechanism in calmodulin- mediated signal transduction PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1g4y ( Chain: R) .60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium- calmodulin PDB_Info PDB_Structure Rattus norvegicus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1mux ( Chain: A) Solution nmr structure of calmodulin/w-7 complex: the basis of diversity in molecular recognition, 30 structures PDB_Info PDB_Structure Xenopus laevis 3.9e-19 43 29 View alignment SCOP MMDB CATH 1x02 ( Chain: A) Solution structure of stereo array isotope labeled (sail) calmodulin PDB_Info PDB_Structure Xenopus laevis 3.9e-19 43 29 View alignment SCOP MMDB CATH 3dvk ( Chain: A) Crystal structure of ca2+/cam-cav2.3 iq domain complex PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1a29 ( Chain: A) Calmodulin complexed with trifluoperazine (1:2 complex) PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1qx7 ( Chain: R, I, A, M, B) Crystal structure of apocam bound to the gating domain of small conductance ca2+-activated potassium channel PDB_Info PDB_Structure Rattus norvegicus Chain R = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain I = 3.9e-19 43 29 View alignment Chain A = 3.9e-19 43 29 View alignment Chain M = 3.9e-19 43 29 View alignment Chain B = 3.9e-19 43 29 View alignment 1cm4 ( Chain: A) Motions of calmodulin-four-conformer refinement PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1qx5 ( Chain: K, D, B, R, T, J, I, Y) Crystal structure of apocalmodulin PDB_Info PDB_Structure Rattus norvegicus Chain K = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain D = 3.9e-19 43 29 View alignment Chain B = 3.9e-19 43 29 View alignment Chain R = 3.9e-19 43 29 View alignment Chain T = 3.9e-19 43 29 View alignment Chain J = 3.9e-19 43 29 View alignment Chain I = 3.9e-19 43 29 View alignment Chain Y = 3.9e-19 43 29 View alignment 1sk6 ( Chain: D, F, E) Crystal structure of the adenylyl cyclase domain of anthrax edema factor (ef) in complex with calmodulin, 3',5' cyclic amp (camp), and pyrophosphate PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain D = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain F = 3.9e-19 43 29 View alignment Chain E = 3.9e-19 43 29 View alignment 1niw ( Chain: G, E, C, A) Crystal structure of endothelial nitric oxide synthase peptide bound to calmodulin PDB_Info PDB_Structure Rattus norvegicus Chain G = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain E = 3.9e-19 43 29 View alignment Chain C = 3.9e-19 43 29 View alignment Chain A = 3.9e-19 43 29 View alignment 1k90 ( Chain: F, D, E) Crystal structure of the adenylyl cyclase domain of anthrax edema factor (ef) in complex with calmodulin and 3' deoxy- atp PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain F = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain D = 3.9e-19 43 29 View alignment Chain E = 3.9e-19 43 29 View alignment 1nwd ( Chain: A) Solution structure of ca2+/calmodulin bound to the c- terminal domain of petunia glutamate decarboxylase PDB_Info PDB_Structure Xenopus laevis | Petunia x hybrida 3.9e-19 43 29 View alignment SCOP MMDB CATH 1up5 ( Chain: B, A) Chicken calmodulin PDB_Info PDB_Structure Gallus gallus Chain B = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain A = 3.9e-19 43 29 View alignment 3g43 ( Chain: D, C, A, B) Crystal structure of the calmodulin-bound cav1.2 c-terminal regulatory domain dimer PDB_Info PDB_Structure Homo sapiens Chain D = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain C = 3.9e-19 43 29 View alignment Chain A = 3.9e-19 43 29 View alignment Chain B = 3.9e-19 43 29 View alignment 2o5g ( Chain: A) Calmodulin-smooth muscle light chain kinase peptide complex PDB_Info PDB_Structure Gallus gallus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2hqw ( Chain: A) Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide PDB_Info PDB_Structure Rattus norvegicus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1s26 ( Chain: F, E, D) Structure of anthrax edema factor-calmodulin-alpha,beta- methyleneadenosine 5'-triphosphate complex reveals an alternative mode of atp binding to the catalytic site PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain F = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain E = 3.9e-19 43 29 View alignment Chain D = 3.9e-19 43 29 View alignment 1cff ( Chain: A) Nmr solution structure of a complex of calmodulin with a binding peptide of the ca2+-pump PDB_Info PDB_Structure Xenopus laevis | Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1cfc ( Chain: A) Calcium-free calmodulin PDB_Info PDB_Structure Xenopus laevis 3.9e-19 43 29 View alignment SCOP MMDB CATH 2k0f ( Chain: A) Calmodulin complexed with calmodulin-binding peptide from smooth muscle myosin light chain kinase PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1ctr ( Chain: A) Drug binding by calmodulin: crystal structure of a calmodulin-trifluoperazine complex PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 3bxl ( Chain: A) Crystal structure of the r-type calcium channel (cav2.3) iq domain and ca2+calmodulin complex PDB_Info PDB_Structure Rattus norvegicus 3.9e-19 43 29 View alignment SCOP MMDB CATH 3dve ( Chain: A) Crystal structure of ca2+/cam-cav2.2 iq domain complex PDB_Info PDB_Structure Homo sapiens | Oryctolagus cuniculus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1sy9 ( Chain: A) Structure of calmodulin complexed with a fragment of the olfactory cng channel PDB_Info PDB_Structure Xenopus laevis 3.9e-19 43 29 View alignment SCOP MMDB CATH 3bxk ( Chain: C, A) Crystal structure of the p/q-type calcium channel (cav2.1) iq domain and ca2+calmodulin complex PDB_Info PDB_Structure Rattus norvegicus Chain C = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain A = 3.9e-19 43 29 View alignment 1cll ( Chain: A) Calmodulin structure refined at 1.7 angstroms resolution PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1ckk ( Chain: A) Calmodulin/rat ca2+/calmodulin dependent protein kinase fragment PDB_Info PDB_Structure Xenopus laevis | Rattus norvegicus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2f3z ( Chain: A) Calmodulin/iq-aa domain complex PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1prw ( Chain: A) Crystal structure of bovine brain ca++ calmodulin in a compact form PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1pk0 ( Chain: E, F, D) Crystal structure of the ef3-cam complexed with pmeapp PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain E = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain F = 3.9e-19 43 29 View alignment Chain D = 3.9e-19 43 29 View alignment 1cdl ( Chain: B, A, D, C) Target enzyme recognition by calmodulin: 2.4 angstroms structure of a calmodulin-peptide complex PDB_Info PDB_Structure Homo sapiens Chain B = 3.9e-19 43 29 View alignment SCOP MMDB CATH Chain A = 3.9e-19 43 29 View alignment Chain D = 3.9e-19 43 29 View alignment Chain C = 3.9e-19 43 29 View alignment 2jzi ( Chain: A) Structure of calmodulin complexed with the calmodulin binding domain of calcineurin PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1lin ( Chain: A) Calmodulin complexed with trifluoperazine (1:4 complex) PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1iwq ( Chain: A) Crystal structure of marcks calmodulin binding domain peptide complexed with ca2+/calmodulin PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 2f3y ( Chain: A) Calmodulin/iq domain complex PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 3bya ( Chain: A) Structure of a calmodulin complex PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1qiv ( Chain: A) Calmodulin complexed with n-(3,3,-diphenylpropyl)-n'-[1-r-( 3,4-bis-butoxyphenyl)-ethyl]-propylenediamine (dpd), 1:2 complex PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1yr5 ( Chain: A) .7-a structure of calmodulin bound to a peptide from dap kinase PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 2bcx ( Chain: A) Crystal structure of calmodulin in complex with a ryanodine receptor peptide PDB_Info PDB_Structure Gallus gallus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2fot ( Chain: A) Crystal structure of the complex between calmodulin and alphaii-spectrin PDB_Info PDB_Structure Bos taurus | Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 3dvm ( Chain: A) Crystal structure of ca2+/cam-cav2.1 iq domain complex PDB_Info PDB_Structure Homo sapiens | Oryctolagus cuniculus 3.9e-19 43 29 View alignment SCOP MMDB CATH 3dvj ( Chain: A) Crystal structure of ca2+/cam-cav2.2 iq domain (without cloning artifact, hm to tv) complex PDB_Info PDB_Structure Homo sapiens | Oryctolagus cuniculus 3.9e-19 43 29 View alignment SCOP MMDB CATH 1l7z ( Chain: A) Crystal structure of ca2+/calmodulin complexed with myristoylated cap-23/nap-22 peptide PDB_Info PDB_Structure Homo sapiens 3.9e-19 43 29 View alignment SCOP MMDB CATH 1cm1 ( Chain: A) Motions of calmodulin-single-conformer refinement PDB_Info PDB_Structure Bos taurus 3.9e-19 43 29 View alignment SCOP MMDB CATH 2bbm ( Chain: A) Solution structure of a calmodulin-target peptide complex by multidimensional nmr PDB_Info PDB_Structure Drosophila melanogaster 4.6e-19 43 29 View alignment SCOP MMDB CATH 1mxe ( Chain: B, A) Structure of the complex of calmodulin with the target sequence of camki PDB_Info PDB_Structure Drosophila melanogaster Chain B = 4.6e-19 43 29 View alignment SCOP MMDB CATH Chain A = 4.6e-19 43 29 View alignment 2k0j ( Chain: A) Solution structure of cam complexed to drp1p PDB_Info PDB_Structure Homo sapiens 4.6e-19 43 29 View alignment SCOP MMDB CATH 2k61 ( Chain: A) Calmodulin PDB_Info PDB_Structure Unknown 4.6e-19 43 29 View alignment SCOP MMDB CATH 2bbn ( Chain: A) Solution structure of a calmodulin-target peptide complex by multidimensional nmr PDB_Info PDB_Structure Drosophila melanogaster 4.6e-19 43 29 View alignment SCOP MMDB CATH 4cln ( Chain: A) Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution PDB_Info PDB_Structure Drosophila melanogaster 4.6e-19 43 29 View alignment SCOP MMDB CATH 1rfj ( Chain: A) Crystal structure of potato calmodulin pcm6 PDB_Info PDB_Structure Solanum tuberosum 4.6e-19 42 31 View alignment SCOP MMDB CATH 1cdm ( Chain: A) Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures PDB_Info PDB_Structure Bos taurus 5.2e-19 43 28 View alignment SCOP MMDB CATH 1k93 ( Chain: D, E, F) Crystal structure of the adenylyl cyclase domain of anthrax edema factor (ef) in complex with calmodulin PDB_Info PDB_Structure Bacillus anthracis | Homo sapiens Chain D = 9.6e-19 43 29 View alignment SCOP MMDB CATH Chain E = 9.6e-19 43 29 View alignment Chain F = 9.6e-19 43 29 View alignment 1y0v ( Chain: M, L, J, I, K, H) Crystal structure of anthrax edema factor (ef) in complex with calmodulin and pyrophosphate PDB_Info PDB_Structure Bacillus anthracis | Xenopus laevis Chain M = 9.6e-19 43 29 View alignment SCOP MMDB CATH Chain L = 9.6e-19 43 29 View alignment Chain J = 9.6e-19 43 29 View alignment Chain I = 9.6e-19 43 29 View alignment Chain K = 9.6e-19 43 29 View alignment Chain H = 9.6e-19 43 29 View alignment 1y6w ( Chain: A) Trapped intermediate of calmodulin PDB_Info PDB_Structure Homo sapiens 9.8e-19 42 30 View alignment SCOP MMDB CATH 1dmo ( Chain: A) Calmodulin, nmr, 30 structures PDB_Info PDB_Structure Xenopus laevis 9.8e-19 42 30 View alignment SCOP MMDB CATH 3cln ( Chain: A) Structure of calmodulin refined at 2.2 angstroms resolution PDB_Info PDB_Structure Rattus rattus 9.8e-19 42 30 View alignment SCOP MMDB CATH 1ahr ( Chain: A) Calmodulin mutant with a two residue deletion in the central helix PDB_Info PDB_Structure Gallus gallus 1.1e-18 43 30 View alignment SCOP MMDB CATH 3evr ( Chain: A) Crystal structure of calcium bound monomeric gcamp2 PDB_Info PDB_Structure Aequorea victoria 1.2e-18 43 29 View alignment SCOP MMDB CATH 3ek4 ( Chain: A) Calcium-saturated gcamp2 monomer PDB_Info PDB_Structure Artificial gene 1.4e-18 43 29 View alignment SCOP MMDB CATH 3ek7 ( Chain: A) Calcium-saturated gcamp2 dimer PDB_Info PDB_Structure Artificial gene 1.4e-18 43 29 View alignment SCOP MMDB CATH 3evu ( Chain: A) Crystal structure of calcium bound dimeric gcamp2, (#1) PDB_Info PDB_Structure Aequorea victoria 1.4e-18 43 29 View alignment SCOP MMDB CATH 3evv ( Chain: A) Crystal structure of calcium bound dimeric gcamp2 (#2) PDB_Info PDB_Structure Aequorea victoria 1.4e-18 43 29 View alignment SCOP MMDB CATH 3ek8 ( Chain: A) Calcium-saturated gcamp2 t116v/g87r mutant monomer PDB_Info PDB_Structure Artificial gene 1.4e-18 43 29 View alignment SCOP MMDB CATH 1qtx ( Chain: A) The 1.65 angstrom structure of calmodulin rs20 peptide complex PDB_Info PDB_Structure Escherichia coli 1.7e-18 42 30 View alignment SCOP MMDB CATH 1qs7 ( Chain: C, A) The 1.8 angstrom structure of calmodulin rs20 peptide complex PDB_Info PDB_Structure Escherichia coli Chain C = 2.4e-18 43 29 View alignment SCOP MMDB CATH Chain A = 2.4e-18 43 29 View alignment 1vrk ( Chain: A) The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex PDB_Info PDB_Structure synthetic construct 3.7e-18 42 30 View alignment SCOP MMDB CATH 1clm ( Chain: A) Structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution PDB_Info PDB_Structure Paramecium tetraurelia 5.1e-18 43 30 View alignment SCOP MMDB CATH 3ekh ( Chain: A) Calcium-saturated gcamp2 t116v/k378w mutant monomer PDB_Info PDB_Structure Artificial gene 5.2e-18 42 29 View alignment SCOP MMDB CATH 1deg ( Chain: A) The linker of des-glu84 calmodulin is bent as seen in the crystal structure PDB_Info PDB_Structure Bos taurus 9.1e-18 43 29 View alignment SCOP MMDB CATH 1n0y ( Chain: A, B) Crystal structure of pb-bound calmodulin PDB_Info PDB_Structure Paramecium tetraurelia Chain A = 9.5e-18 42 31 View alignment SCOP MMDB CATH Chain B = 9.5e-18 42 31 View alignment 1osa ( Chain: A) Crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution PDB_Info PDB_Structure Paramecium tetraurelia 9.5e-18 42 31 View alignment SCOP MMDB CATH 1exr ( Chain: A) The 1.0 angstrom crystal structure of ca+2 bound calmodulin PDB_Info PDB_Structure Paramecium tetraurelia 9.5e-18 42 31 View alignment SCOP MMDB CATH 1ggz ( Chain: A) Crystal structure of the calmodulin-like protein (hclp) from human epithelial cells PDB_Info PDB_Structure Homo sapiens 4.3e-17 40 30 View alignment SCOP MMDB CATH 3ekj ( Chain: A) Calcium-free gcamp2 (calcium binding deficient mutant) PDB_Info PDB_Structure Artificial gene 4.9e-16 40 29 View alignment SCOP MMDB CATH 1m39 ( Chain: A) Solution structure of the c-terminal fragment (f86-i165) of the human centrin 2 in calcium saturated form PDB_Info PDB_Structure Homo sapiens 1.3e-15 62 23 View alignment SCOP MMDB CATH 1lkj ( Chain: A) Nmr structure of apo calmodulin from yeast saccharomyces cerevisiae PDB_Info PDB_Structure Saccharomyces cerevisiae 2.2e-15 38 33 View alignment SCOP MMDB CATH 2joj ( Chain: A) Nmr solution structure of n-terminal domain of euplotes octocarinatus centrin PDB_Info PDB_Structure Euplotes octocarinatus 8.6e-14 62 17 View alignment SCOP MMDB CATH 2k2i ( Chain: A) Nmr solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a repeat sequence of human sfi1 (r641-t660) PDB_Info PDB_Structure Homo sapiens 1.8e-13 65 24 View alignment SCOP MMDB CATH 2a4j ( Chain: A) Solution structure of the c-terminal domain (t94-y172) of the human centrin 2 in complex with a 17 residues peptide (p1-xpc) from xeroderma pigmentosum group c protein PDB_Info PDB_Structure Homo sapiens 1.8e-13 65 24 View alignment SCOP MMDB CATH 2jnf ( Chain: A) Solution structure of fly troponin c, isoform f1 PDB_Info PDB_Structure Lethocerus indicus 1.1e-11 33 34 View alignment SCOP MMDB CATH 1oqp ( Chain: A) Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p PDB_Info PDB_Structure Chlamydomonas reinhardtii 4.9e-11 63 22 View alignment SCOP MMDB CATH 1zmz ( Chain: A) Solution structure of the n-terminal domain (m1-s98) of human centrin 2 PDB_Info PDB_Structure Homo sapiens 1.1e-10 51 22 View alignment SCOP MMDB CATH 1a2x ( Chain: A) Complex of troponin c with a 47 residue (1-47) fragment of troponin i PDB_Info PDB_Structure Oryctolagus cuniculus 1.7e-10 31 36 View alignment SCOP MMDB CATH 1tcf ( Chain: A) Crystal structure of calcium-saturated rabbit skeletal troponin c PDB_Info PDB_Structure Oryctolagus cuniculus 1.9e-10 31 36 View alignment SCOP MMDB CATH 2tn4 ( Chain: A) Four calcium tnc PDB_Info PDB_Structure Oryctolagus cuniculus 1.9e-10 31 36 View alignment SCOP MMDB CATH 1la0 ( Chain: A) Solution structure of calcium saturated cardiac troponin c in the troponin c-troponin i complex PDB_Info PDB_Structure Gallus gallus 1.9e-10 30 38 View alignment SCOP MMDB CATH 1tn4 ( Chain: A) Four calcium tnc PDB_Info PDB_Structure Oryctolagus cuniculus 1.9e-10 31 36 View alignment SCOP MMDB CATH 1j1e ( Chain: A, D) Crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form PDB_Info PDB_Structure Homo sapiens Chain A = 2.8e-10 30 38 View alignment SCOP MMDB CATH Chain D = 2.8e-10 30 38 View alignment 1aj4 ( Chain: A) Structure of calcium-saturated cardiac troponin c, nmr, 1 structure PDB_Info PDB_Structure Gallus gallus 2.8e-10 30 38 View alignment SCOP MMDB CATH 1j1d ( Chain: A, D) Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form PDB_Info PDB_Structure Homo sapiens Chain A = 2.8e-10 30 38 View alignment SCOP MMDB CATH Chain D = 2.8e-10 30 38 View alignment 1dtl ( Chain: A) Crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution PDB_Info PDB_Structure Gallus gallus 2.8e-10 30 38 View alignment SCOP MMDB CATH 2jt3 ( Chain: A) Solution structure of f153w cardiac troponin c PDB_Info PDB_Structure Homo sapiens 1.0e-09 30 38 View alignment SCOP MMDB CATH 2jt8 ( Chain: A) Solution structure of the f153-to-5-flurotryptophan mutant of human cardiac troponin c PDB_Info PDB_Structure Homo sapiens 1.0e-09 30 38 View alignment SCOP MMDB CATH 2jt0 ( Chain: A) Solution structure of f104w cardiac troponin c PDB_Info PDB_Structure Homo sapiens 1.0e-09 30 38 View alignment SCOP MMDB CATH 2jtz ( Chain: A) Solution structure and chemical shift assignments of the f104-to-5-flurotryptophan mutant of cardiac troponin c PDB_Info PDB_Structure Homo sapiens 1.0e-09 30 38 View alignment SCOP MMDB CATH 1s6i ( Chain: A) Ca2+-regulatory region (cld) from soybean calcium-dependent protein kinase-alpha (cdpk) in the presence of ca2+ and the junction domain (jd) PDB_Info PDB_Structure Glycine max 1.2e-09 33 32 View alignment SCOP MMDB CATH 5tnc ( Chain: A) Refined crystal structure of troponin c from turkey skeletal muscle at 2.0 angstroms resolution PDB_Info PDB_Structure Meleagris gallopavo 1.4e-09 29 38 View alignment SCOP MMDB CATH 1ncz ( Chain: A) Troponin c PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 1yv0 ( Chain: C) Crystal structure of skeletal muscle troponin in the ca2+- free state PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 1ytz ( Chain: C) Crystal structure of skeletal muscle troponin in the ca2+- activated state PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 1ncy ( Chain: A) Troponin-c, complex with manganese PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 1ncx ( Chain: A) Troponin c PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 1top ( Chain: A) Structure of chicken skeletal muscle troponin-c at 1.78 angstroms resolution PDB_Info PDB_Structure Gallus gallus 1.6e-09 29 37 View alignment SCOP MMDB CATH 4tnc ( Chain: A) Refined structure of chicken skeletal muscle troponin c in the two-calcium state at 2-angstroms resolution PDB_Info PDB_Structure Gallus gallus 2.0e-09 29 37 View alignment SCOP MMDB CATH 2aao ( Chain: B, A) Regulatory apparatus of calcium dependent protein kinase from arabidopsis thaliana PDB_Info PDB_Structure Arabidopsis thaliana Chain B = 2.7e-09 31 36 View alignment SCOP MMDB CATH Chain A = 2.7e-09 31 36 View alignment 1tnx ( Chain: A) Nmr solution structure of calcium saturated skeletal muscle troponin c PDB_Info PDB_Structure Gallus gallus 4.2e-09 29 37 View alignment SCOP MMDB CATH 1tnw ( Chain: A) Nmr solution structure of calcium saturated skeletal muscle troponin c PDB_Info PDB_Structure Gallus gallus 4.2e-09 29 37 View alignment SCOP MMDB CATH 3i5f ( Chain: B, C) Myosin regulatory light PDB_Info PDB_Structure Unknown Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 2ovk ( Chain: B, C) Crystal structure of rigor-like squid myosin s1 PDB_Info PDB_Structure Loligo pealei | Todarodes pacificus Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 2ekw ( Chain: B, C) The crystal structure of squid myosin s1 in the presence of so4 2- PDB_Info PDB_Structure Loligo pealei | Todarodes pacificus Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 3i5h ( Chain: B, C) Myosin regulatory light PDB_Info PDB_Structure Unknown Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 2oy6 ( Chain: B, C) Crystal structure of squid mg.adp myosin s1 PDB_Info PDB_Structure Loligo pealei | Todarodes pacificus Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 2ekv ( Chain: B, C) The crystal structure of rigor like squid myosin s1 in the absence of nucleotide PDB_Info PDB_Structure Loligo pealei | Todarodes pacificus Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 3i5i ( Chain: B, C) Myosin regulatory light PDB_Info PDB_Structure Unknown Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 3i5g ( Chain: B, C) Myosin regulatory light PDB_Info PDB_Structure Unknown Chain B = 5.3e-09 28 36 View alignment SCOP MMDB CATH Chain C = 0.000739 26 35 View alignment 2otg ( Chain: B, C) Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor PDB_Info PDB_Structure Placopecten magellanicus Chain B = 8.6e-09 28 37 View alignment SCOP MMDB CATH Chain C = 0.000139 28 33 View alignment 2os8 ( Chain: B, C) Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor PDB_Info PDB_Structure Placopecten magellanicus Chain B = 8.6e-09 28 37 View alignment SCOP MMDB CATH Chain C = 0.000139 28 33 View alignment 2ami ( Chain: A) Solution structure of the calcium-loaded n-terminal sensor domain of centrin PDB_Info PDB_Structure Chlamydomonas reinhardtii 9.2e-09 51 24 View alignment SCOP MMDB CATH 2ec6 ( Chain: B, C) Placopecten striated muscle myosin ii PDB_Info PDB_Structure Placopecten magellanicus Chain B = 1.3e-08 27 40 View alignment SCOP MMDB CATH Chain C = 0.000120 28 33 View alignment 2rob ( Chain: A) Solution structure of calcium bound soybean calmodulin isoform 4 c-terminal domain PDB_Info PDB_Structure Glycine max 1.5e-08 52 30 View alignment SCOP MMDB CATH 2kn2 ( Chain: A) Calmodulin PDB_Info PDB_Structure Unknown 1.8e-08 50 29 View alignment SCOP MMDB CATH 1yru ( Chain: B) Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin and 1mm calcium chloride PDB_Info PDB_Structure Bordetella pertussis | Homo sapiens 2.7e-08 49 25 View alignment SCOP MMDB CATH 1yrt ( Chain: B) Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin PDB_Info PDB_Structure Bordetella pertussis | Homo sapiens 2.7e-08 49 25 View alignment SCOP MMDB CATH 3dtp ( Chain: F, E, D, C) Tarantula heavy meromyosin obtained by flexible docking to tarantula muscle thick filament cryo-em 3d-map PDB_Info PDB_Structure Gallus gallus, homo sapiens Chain F = 3.1e-08 28 36 View alignment SCOP MMDB CATH Chain E = 3.1e-08 28 36 View alignment Chain D = 1.4e-06 28 36 View alignment Chain C = 1.4e-06 28 36 View alignment 2ro9 ( Chain: A) Solution structure of calcium bound soybean calmodulin isoform 1 c-terminal domain PDB_Info PDB_Structure Glycine max 3.8e-08 52 27 View alignment SCOP MMDB CATH 1zot ( Chain: B) Crystal structure analysis of the cyaa/c-cam with pmeapp PDB_Info PDB_Structure Bordetella pertussis | Homo sapiens 3.8e-08 51 25 View alignment SCOP MMDB CATH 1fw4 ( Chain: A) Crystal structure of e. coli fragment tr2c from calmodulin to 1.7 a resolution PDB_Info PDB_Structure Bos taurus 4.0e-08 51 25 View alignment SCOP MMDB CATH 1cmg ( Chain: A) Nmr solution structure of calcium-loaded calmodulin carboxy- terminal domain PDB_Info PDB_Structure Bos taurus 4.1e-08 51 25 View alignment SCOP MMDB CATH 1cmf ( Chain: A) Nmr solution structure of apo calmodulin carboxy-terminal domain PDB_Info PDB_Structure Bos taurus 4.1e-08 51 25 View alignment SCOP MMDB CATH 2eqc ( Chain: A) Solution structure of magnesium-bound form of calmodulin c- domain e104d/e140d mutant PDB_Info PDB_Structure Xenopus laevis 4.8e-08 47 27 View alignment SCOP MMDB CATH 2col ( Chain: B) Crystal structure analysis of cyaa/c-cam with pyrophosphate PDB_Info PDB_Structure Bordetella pertussis | Xenopus laevis 5.9e-08 51 26 View alignment SCOP MMDB CATH 1wdc ( Chain: B, C) Scallop myosin regulatory domain PDB_Info PDB_Structure Argopecten irradians Chain B = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1qvi ( Chain: Y, Z) Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head PDB_Info PDB_Structure Argopecten irradians Chain Y = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain Z = 0.000289 26 35 View alignment 1s5g ( Chain: Y, Z) Structure of scallop myosin s1 reveals a novel nucleotide conformation PDB_Info PDB_Structure Argopecten irradians Chain Y = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain Z = 0.000289 26 35 View alignment 1kwo ( Chain: B, C) Scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation PDB_Info PDB_Structure Argopecten irradians Chain B = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1kqm ( Chain: B, C) Scallop myosin s1-amppnp in the actin-detached conformation PDB_Info PDB_Structure Argopecten irradians Chain B = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1sr6 ( Chain: B, C) Structure of nucleotide-free scallop myosin s1 PDB_Info PDB_Structure Argopecten irradians Chain B = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1b7t ( Chain: Y, Z) Myosin digested by papain PDB_Info PDB_Structure Argopecten irradians Chain Y = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain Z = 0.000289 26 35 View alignment 1kk7 ( Chain: Y, Z) Scallop myosin in the near rigor conformation PDB_Info PDB_Structure Argopecten irradians Chain Y = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain Z = 0.000289 26 35 View alignment 1l2o ( Chain: B, C) Scallop myosin s1-adp-p-pdm in the actin-detached conformation PDB_Info PDB_Structure Argopecten irradians Chain B = 6.1e-08 26 39 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1f71 ( Chain: A) Refined solution structure of calmodulin c-terminal domain PDB_Info PDB_Structure Xenopus laevis 6.9e-08 52 26 View alignment SCOP MMDB CATH 1j7p ( Chain: A) Solution structure of calcium calmodulin c-terminal domain PDB_Info PDB_Structure Homo sapiens 6.9e-08 52 26 View alignment SCOP MMDB CATH 2k3s ( Chain: B) Haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin PDB_Info PDB_Structure Mus musculus | Xenopus laevis 6.9e-08 52 26 View alignment SCOP MMDB CATH 3igo ( Chain: A) Calmodulin-domain prote PDB_Info PDB_Structure Unknown 8.7e-08 34 26 View alignment SCOP MMDB CATH 1scm ( Chain: B, C) Structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution PDB_Info PDB_Structure Argopecten irradians Chain B = 1.3e-07 26 39 View alignment SCOP MMDB CATH Chain C = 0.000380 27 34 View alignment 1dfl ( Chain: Y, W, X, Z) Scallop myosin s1 complexed with mgadp:vanadate-transition state PDB_Info PDB_Structure Argopecten irradians Chain Y = 1.6e-07 26 40 View alignment SCOP MMDB CATH Chain W = 1.6e-07 26 40 View alignment Chain X = 0.000330 26 34 View alignment Chain Z = 0.000330 26 34 View alignment 1kk8 ( Chain: B, C) Scallop myosin (s1-adp-befx) in the actin-detached conformation PDB_Info PDB_Structure Argopecten irradians Chain B = 1.6e-07 25 40 View alignment SCOP MMDB CATH Chain C = 0.000289 26 35 View alignment 1dfk ( Chain: Y, Z) Nucleotide-free scallop myosin s1-near rigor state PDB_Info PDB_Structure Argopecten irradians Chain Y = 1.6e-07 26 40 View alignment SCOP MMDB CATH Chain Z = 0.000330 26 34 View alignment 1n2d ( Chain: A, B) Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 6.5e-07 31 32 View alignment SCOP MMDB CATH Chain B = 6.5e-07 31 32 View alignment 1m46 ( Chain: A) Crystal structure of mlc1p bound to iq4 of myo2p, a class v myosin PDB_Info PDB_Structure Saccharomyces cerevisiae 6.5e-07 31 32 View alignment SCOP MMDB CATH 1m45 ( Chain: A) Crystal structure of mlc1p bound to iq2 of myo2p, a class v myosin PDB_Info PDB_Structure Saccharomyces cerevisiae 6.5e-07 31 32 View alignment SCOP MMDB CATH 2mys ( Chain: B) Myosin subfragment-1, alpha carbon coordinates only for the two light chains PDB_Info PDB_Structure Gallus gallus 7.3e-07 30 29 View alignment SCOP MMDB CATH 1i84 ( Chain: Z, U, W, T) Cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. only c alphas provided for regulatory light chain. only backbone atoms provided for s2 fragment. PDB_Info PDB_Structure Gallus gallus Chain Z = 7.3e-07 30 29 View alignment SCOP MMDB CATH Chain U = 7.3e-07 30 29 View alignment Chain W = 1.4e-06 28 36 View alignment Chain T = 1.4e-06 28 36 View alignment 1br4 ( Chain: B, H, D, F) Smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site PDB_Info PDB_Structure Gallus gallus Chain B = 1.4e-06 28 36 View alignment SCOP MMDB CATH Chain H = 1.4e-06 28 36 View alignment Chain D = 1.4e-06 28 36 View alignment Chain F = 1.4e-06 28 36 View alignment 1br1 ( Chain: H, D, B, F) Smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site PDB_Info PDB_Structure Gallus gallus Chain H = 1.4e-06 28 36 View alignment SCOP MMDB CATH Chain D = 1.4e-06 28 36 View alignment Chain B = 1.4e-06 28 36 View alignment Chain F = 1.4e-06 28 36 View alignment 2bl0 ( Chain: C, B) Physarum polycephalum myosin ii regulatory domain PDB_Info PDB_Structure Physarum polycephalum Chain C = 2.0e-06 26 35 View alignment SCOP MMDB CATH Chain B = 9.7e-06 29 34 View alignment 1o1b ( Chain: B, K, E, H) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain B = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain K = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment 1o1d ( Chain: Q, E, N, B, K, H) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain Q = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain E = 2.8e-06 30 29 View alignment Chain N = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment Chain K = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment 1mvw ( Chain: E, N, H, Q, B, K) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain E = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain N = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment Chain Q = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment Chain K = 2.8e-06 30 29 View alignment 1o19 ( Chain: K, B, H, N, E, T) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain K = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain B = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment Chain N = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment Chain T = 2.8e-06 30 29 View alignment 1o1f ( Chain: K, H, E, B) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain K = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain H = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment 1m8q ( Chain: E, B, Q, H) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain E = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain B = 2.8e-06 30 29 View alignment Chain Q = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment 1o1c ( Chain: Q, E, B, H, K) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain Q = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain E = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment Chain K = 2.8e-06 30 29 View alignment 1o18 ( Chain: K, N, Q, H, E) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain K = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain N = 2.8e-06 30 29 View alignment Chain Q = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment 1o1e ( Chain: E, H, N, B, Q, K) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain E = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain H = 2.8e-06 30 29 View alignment Chain N = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment Chain Q = 2.8e-06 30 29 View alignment Chain K = 2.8e-06 30 29 View alignment 1o1g ( Chain: B, Q, K, H, N, E) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain B = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain Q = 2.8e-06 30 29 View alignment Chain K = 2.8e-06 30 29 View alignment Chain H = 2.8e-06 30 29 View alignment Chain N = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment 1o1a ( Chain: K, H, N, Q, B, E) Molecular models of averaged rigor crossbridges from tomograms of insect flight muscle PDB_Info PDB_Structure Gallus gallus | Oryctolagus cuniculus Chain K = 2.8e-06 30 29 View alignment SCOP MMDB CATH Chain H = 2.8e-06 30 29 View alignment Chain N = 2.8e-06 30 29 View alignment Chain Q = 2.8e-06 30 29 View alignment Chain B = 2.8e-06 30 29 View alignment Chain E = 2.8e-06 30 29 View alignment 1f55 ( Chain: A) Solution structure of the calcium bound n-terminal domain of yeast calmodulin PDB_Info PDB_Structure Saccharomyces cerevisiae 5.5e-06 37 37 View alignment SCOP MMDB CATH 1f54 ( Chain: A) Solution structure of the apo n-terminal domain of yeast calmodulin PDB_Info PDB_Structure Saccharomyces cerevisiae 5.5e-06 37 37 View alignment SCOP MMDB CATH 1w7j ( Chain: B) Crystal structure of myosin v motor with essential light chain + adp-befx - near rigor PDB_Info PDB_Structure Gallus gallus | Homo sapiens 6.4e-06 29 33 View alignment SCOP MMDB CATH 1w7i ( Chain: B) Crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp PDB_Info PDB_Structure Gallus gallus | Homo sapiens 6.4e-06 29 33 View alignment SCOP MMDB CATH 1oe9 ( Chain: B) Crystal structure of myosin v motor with essential light chain - nucleotide-free PDB_Info PDB_Structure Gallus gallus | Homo sapiens 6.4e-06 29 33 View alignment SCOP MMDB CATH 2b1u ( Chain: A) Solution structure of calmodulin-like skin protein c terminal domain PDB_Info PDB_Structure Homo sapiens 9.3e-06 46 29 View alignment SCOP MMDB CATH 2k2a ( Chain: A) Solution structure of the apo c terminal domain of lethocerus troponin c isoform f1 PDB_Info PDB_Structure Lethocerus indicus 1.5e-05 43 35 View alignment SCOP MMDB CATH 1sw8 ( Chain: A) Solution structure of the n-terminal domain of human n60d calmodulin refined with paramagnetism based strategy PDB_Info PDB_Structure Homo sapiens 1.7e-05 44 27 View alignment SCOP MMDB CATH 1k9u ( Chain: A, B) Crystal structure of the calcium-binding pollen allergen phl p 7 (polcalcin) at 1.75 angstroem PDB_Info PDB_Structure Phleum pratense Chain A = 2.2e-05 46 25 View alignment SCOP MMDB CATH Chain B = 2.2e-05 46 25 View alignment 1trf ( Chain: A) Solution structure of the tr1c fragment of skeletal muscle troponin-c PDB_Info PDB_Structure Meleagris gallopavo 2.4e-05 46 26 View alignment SCOP MMDB CATH 1ak8 ( Chain: A) Nmr solution structure of cerium-loaded calmodulin amino- terminal domain (ce2-tr1c), 23 structures PDB_Info PDB_Structure Bos taurus 2.9e-05 37 33 View alignment SCOP MMDB CATH 1f70 ( Chain: A) Refined solution structure of calmodulin n-terminal domain PDB_Info PDB_Structure Xenopus laevis 2.9e-05 38 32 View alignment SCOP MMDB CATH 1j7o ( Chain: A) Solution structure of calcium-calmodulin n-terminal domain PDB_Info PDB_Structure Homo sapiens 2.9e-05 38 32 View alignment SCOP MMDB CATH 2pq3 ( Chain: A) N-terminal calmodulin zn-trapped intermediate PDB_Info PDB_Structure Rattus norvegicus 2.9e-05 38 32 View alignment SCOP MMDB CATH 1skt ( Chain: A) Solution structure of apo n-domain of troponin c, nmr, 40 structures PDB_Info PDB_Structure Gallus gallus 3.0e-05 46 26 View alignment SCOP MMDB CATH 1tnp ( Chain: A) Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch PDB_Info PDB_Structure Gallus gallus 3.0e-05 46 26 View alignment SCOP MMDB CATH 1tnq ( Chain: A) Structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch PDB_Info PDB_Structure Gallus gallus 3.0e-05 46 26 View alignment SCOP MMDB CATH 1avs ( Chain: A, B) X-ray crystallographic study of calcium-saturated n- terminal domain of troponin c PDB_Info PDB_Structure Gallus gallus Chain A = 3.0e-05 46 26 View alignment SCOP MMDB CATH Chain B = 3.0e-05 46 26 View alignment 1zac ( Chain: A) N-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure PDB_Info PDB_Structure Gallus gallus 3.0e-05 46 26 View alignment SCOP MMDB CATH 1blq ( Chain: A) Structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures PDB_Info PDB_Structure Gallus gallus 3.0e-05 46 26 View alignment SCOP MMDB CATH 1smg ( Chain: A) Calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures PDB_Info PDB_Structure Gallus gallus 3.5e-05 46 25 View alignment SCOP MMDB CATH 3b32 ( Chain: A) Crystal structure of calcium-saturated calmodulin n- terminal domain fragment, residues 1-75 PDB_Info PDB_Structure Rattus norvegicus 3.8e-05 43 28 View alignment SCOP MMDB CATH 2i08 ( Chain: A) Solvation effect in conformational changes of ef-hand proteins: x-ray structure of ca2+-saturated double mutant q41l-k75i of n-domain of calmodulin PDB_Info PDB_Structure Homo sapiens 4.0e-05 37 34 View alignment SCOP MMDB CATH 3h4s ( Chain: E) KCBP interacting Ca2+-b PDB_Info PDB_Structure Unknown 4.0e-05 35 34 View alignment SCOP MMDB CATH 1aui ( Chain: B) Human calcineurin heterodimer PDB_Info PDB_Structure Homo sapiens 5.2e-05 27 37 View alignment SCOP MMDB CATH 1mf8 ( Chain: B) Crystal structure of human calcineurin complexed with cyclosporin a and human cyclophilin PDB_Info PDB_Structure Homo sapiens 5.2e-05 27 37 View alignment SCOP MMDB CATH 1m63 ( Chain: F, B) Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes PDB_Info PDB_Structure Homo sapiens Chain F = 5.2e-05 27 37 View alignment SCOP MMDB CATH Chain B = 5.2e-05 27 37 View alignment 1tco ( Chain: B) Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus) PDB_Info PDB_Structure Bos taurus 5.2e-05 27 37 View alignment SCOP MMDB CATH 3i79 ( Chain: A) Calmodulin-domain prote PDB_Info PDB_Structure Unknown 5.8e-05 30 30 View alignment SCOP MMDB CATH 3hx4 ( Chain: A) Calmodulin-domain prote PDB_Info PDB_Structure Unknown 6.0e-05 30 30 View alignment SCOP MMDB CATH 2roa ( Chain: A) Solution structure of calcium bound soybean calmodulin isoform 4 n-terminal domain PDB_Info PDB_Structure Glycine max 6.5e-05 41 32 View alignment SCOP MMDB CATH 2ro8 ( Chain: A) Solution structure of calcium bound soybean calmodulin isoform 1 n-terminal domain PDB_Info PDB_Structure Glycine max 6.5e-05 43 26 View alignment SCOP MMDB CATH 1ggw ( Chain: A) Cdc4p from schizosaccharomyces pombe PDB_Info PDB_Structure Schizosaccharomyces pombe 7.6e-05 29 28 View alignment SCOP MMDB CATH 2p6b ( Chain: D, B) Crystal structure of human calcineurin in complex with pvivit peptide PDB_Info PDB_Structure Homo sapiens Chain D = 8.6e-05 26 39 View alignment SCOP MMDB CATH Chain B = 8.6e-05 26 39 View alignment 3hzt ( Chain: A) Calcium-dependent prote PDB_Info PDB_Structure Unknown 0.000160 32 29 View alignment SCOP MMDB CATH 2fce ( Chain: A) Solution structure of c-lobe myosin light chain from saccharomices cerevisiae PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000160 40 35 View alignment SCOP MMDB CATH 2hf5 ( Chain: A) The structure and function of a novel two-site calcium- binding fragment of calmodulin PDB_Info PDB_Structure Homo sapiens 0.000179 37 32 View alignment SCOP MMDB CATH 1r2u ( Chain: A) Nmr structure of the n domain of trout cardiac troponin c at 30 c PDB_Info PDB_Structure Oncorhynchus mykiss 0.000210 39 31 View alignment SCOP MMDB CATH 1r6p ( Chain: A) Nmr structure of the n-terminal domain of trout cardiac troponin c at 7 c PDB_Info PDB_Structure Oncorhynchus mykiss 0.000210 39 31 View alignment SCOP MMDB CATH 1wrk ( Chain: A, B) Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (orthrombic crystal form) PDB_Info PDB_Structure Homo sapiens Chain A = 0.000239 38 31 View alignment SCOP MMDB CATH Chain B = 0.000239 38 31 View alignment 1wrl ( Chain: D, B, E, F, A, C) Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form) PDB_Info PDB_Structure Homo sapiens Chain D = 0.000239 38 31 View alignment SCOP MMDB CATH Chain B = 0.000239 38 31 View alignment Chain E = 0.000239 38 31 View alignment Chain F = 0.000239 38 31 View alignment Chain A = 0.000239 38 31 View alignment Chain C = 0.000239 38 31 View alignment 2kfx ( Chain: T) Troponin C, slow skeleta PDB_Info PDB_Structure Unknown 0.000250 38 31 View alignment SCOP MMDB CATH 1tiz ( Chain: A) Solution structure of a calmodulin-like calcium-binding domain from arabidopsis thaliana PDB_Info PDB_Structure Arabidopsis thaliana 0.000330 39 38 View alignment SCOP MMDB CATH 1mxl ( Chain: C) Structure of cardiac troponin c-troponin i complex PDB_Info PDB_Structure Homo sapiens 0.000450 39 30 View alignment SCOP MMDB CATH 1ap4 ( Chain: A) Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures PDB_Info PDB_Structure Homo sapiens 0.000450 39 30 View alignment SCOP MMDB CATH 1lxf ( Chain: C) Structure of the regulatory n-domain of human cardiac troponin c in complex with human cardiac troponin-i(147- 163) and bepridil PDB_Info PDB_Structure Homo sapiens 0.000450 39 30 View alignment SCOP MMDB CATH 1spy ( Chain: A) Regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures PDB_Info PDB_Structure Homo sapiens 0.000450 39 30 View alignment SCOP MMDB CATH 1npq ( Chain: A) Structure of a rhodamine-labeled n-domain troponin c mutant (ca2+ saturated) in complex with skeletal troponin i 115- 131 PDB_Info PDB_Structure Gallus gallus 0.000460 43 26 View alignment SCOP MMDB CATH 2ctn ( Chain: A) Structure of calcium-saturated cardiac troponin c, nmr, 30 structures PDB_Info PDB_Structure Gallus gallus 0.000830 37 32 View alignment SCOP MMDB CATH 2kgb ( Chain: C) Nmr solution of the regulatory domain cardiac f77w-troponin c in complex with the cardiac troponin i 144-163 switch peptide PDB_Info PDB_Structure Homo sapiens 0.001300 38 31 View alignment SCOP MMDB CATH 2jxl ( Chain: A) Solution structure of cardiac n-domain troponin c mutant f77w-v82a PDB_Info PDB_Structure Homo sapiens 0.001300 38 31 View alignment SCOP MMDB CATH 2zrt ( Chain: C, H, E, D, B, A, G, F) Crystal structure of zn2+-bound form of des3-23alg-2 PDB_Info PDB_Structure Homo sapiens Chain C = 0.001400 33 33 View alignment SCOP MMDB CATH Chain H = 0.001400 33 33 View alignment Chain E = 0.001400 33 33 View alignment Chain D = 0.001400 33 33 View alignment Chain B = 0.001400 33 33 View alignment Chain A = 0.001400 33 33 View alignment Chain G = 0.001400 33 33 View alignment Chain F = 0.001400 33 33 View alignment 2zrs ( Chain: A, F, G, H, B, E, C, D) Crystal structure of ca2+-bound form of des3-23alg-2 PDB_Info PDB_Structure Homo sapiens Chain A = 0.001400 33 33 View alignment SCOP MMDB CATH Chain F = 0.001400 33 33 View alignment Chain G = 0.001400 33 33 View alignment Chain H = 0.001400 33 33 View alignment Chain B = 0.001400 33 33 View alignment Chain E = 0.001400 33 33 View alignment Chain C = 0.001400 33 33 View alignment Chain D = 0.001400 33 33 View alignment 2zne ( Chain: A, B) Crystal structure of zn2+-bound form of des3-23alg-2 complexed with alix abs peptide PDB_Info PDB_Structure Homo sapiens Chain A = 0.001400 33 33 View alignment SCOP MMDB CATH Chain B = 0.001400 33 33 View alignment 2zn9 ( Chain: B, A) Crystal structure of ca2+-bound form of des3-20alg-2 PDB_Info PDB_Structure Homo sapiens Chain B = 0.001500 33 33 View alignment SCOP MMDB CATH Chain A = 0.001500 33 33 View alignment 2znd ( Chain: A) Crystal structure of ca2+-free form of des3-20alg-2 PDB_Info PDB_Structure Homo sapiens 0.001500 33 33 View alignment SCOP MMDB CATH 2zn8 ( Chain: A) Crystal structure of zn2+-bound form of alg-2 PDB_Info PDB_Structure Homo sapiens 0.001599 33 33 View alignment SCOP MMDB CATH 1hqv ( Chain: A) Structure of apoptosis-linked protein alg-2 PDB_Info PDB_Structure Mus musculus 0.001700 33 33 View alignment SCOP MMDB CATH 4pal ( Chain: A) Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 1pvb ( Chain: A) X-ray structure of a new crystal form of pike 4.10 parvalbumin PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 2pal ( Chain: A) Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 3pal ( Chain: A) Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 2pvb ( Chain: A) Pike parvalbumin (pi 4.10) at low temperature (100k) and atomic resolution (0.91 a). PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 1pal ( Chain: A) Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments PDB_Info PDB_Structure Esox lucius 0.002501 33 31 View alignment SCOP MMDB CATH 1pva ( Chain: B, A) Comparison between the crystal and the solution structures of the ef hand parvalbumin (alpha component from pike muscle) PDB_Info PDB_Structure Esox lucius Chain B = 0.003000 30 31 View alignment SCOP MMDB CATH Chain A = 0.003000 30 31 View alignment 2pas ( Chain: A) Comparison between the crystal and the solution structures of the ef hand parvalbumin PDB_Info PDB_Structure Esox lucius 0.003000 30 31 View alignment SCOP MMDB CATH 3pat ( Chain: A) Comparison between the crystal and the solution structures of the ef hand parvalbumin PDB_Info PDB_Structure Esox lucius 0.003000 30 31 View alignment