---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LCB4/YOR171C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 653885 to 652011 CDS: 653885 - 652011 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LCB4	YOR171C		ORF, Verified	S000005697
Description
Sphingoid long-chain base kinase, responsible for synthesis of long-chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous long-chain bases, localizes to the Golgi and late endosomes

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2007-05-23 UniProtKB D-erythro-sphingosine kinase activity Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42        IDA : Inferred from Direct Assay Assigned on 2002-09-25 SGD diacylglycerol kinase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001206 Assigned on 2007-05-23 UniProtKB kinase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0418 Assigned on 2007-05-23 UniProtKB nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB sphinganine kinase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.7.1.91 Assigned on 2008-02-13 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001206 Assigned on 2007-05-23 UniProtKB calcium-mediated signaling Birchwood CJ, et al. (2001) Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation. J Biol Chem 276(15):11712-8        IMP : Inferred from Mutant Phenotype Assigned on 2002-09-25 SGD lipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0443 Assigned on 2009-10-01 UniProtKB sphingolipid metabolic process Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42        IDA : Inferred from Direct Assay Assigned on 2002-09-25 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0746 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Golgi apparatus Hait NC, et al. (2002) Lcb4p sphingoid base kinase localizes to the Golgi and late endosomes. FEBS Lett 532(1-2):97-102          IDA : Inferred from Direct Assay Assigned on 2002-12-09 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0333 Assigned on 2008-02-14 UniProtKB cortical endoplasmic reticulum Iwaki S, et al. (2007) Intracellular Trafficking Pathway of Yeast Long-chain Base Kinase Lcb4, from Its Synthesis to Its Degradation. J Biol Chem 282(39):28485-92        IDA : Inferred from Direct Assay Assigned on 2007-08-23 SGD endoplasmic reticulum Funato K, et al. (2003) Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae. J Biol Chem 278(9):7325-34        IDA : Inferred from Direct Assay Assigned on 2003-03-12 SGD Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82        IDA : Inferred from Direct Assay Assigned on 2006-06-22 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endosome GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0967 Assigned on 2008-02-14 UniProtKB extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9903 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB membrane fraction Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42        IDA : Inferred from Direct Assay Assigned on 2002-09-25 SGD plasma membrane Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82        IDA : Inferred from Direct Assay Assigned on 2006-06-22 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1003 Assigned on 2009-06-29 UniProtKB soluble fraction Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42        IDA : Inferred from Direct Assay Assigned on 2002-09-25 SGD

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for LCB4/YOR171C for LCB4 About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(1). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (2). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (3, 4). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (5). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (6, 7). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forLCB4/YOR171C for LCB4 1) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            2) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        3) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        4) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      5) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        6) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        7) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        8) Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42        9) Hait NC, et al. (2002) Lcb4p sphingoid base kinase localizes to the Golgi and late endosomes. FEBS Lett 532(1-2):97-102          10) Funato K, et al. (2003) Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae. J Biol Chem 278(9):7325-34        11) Martens JA, et al. (2004) Intergenic transcription is required to repress the Saccharomyces cerevisiae SER3 gene. Nature 429(6991):571-4

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LCB4/YOR171C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LCB4/YOR171C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVVQKKL C-term DTEFESM Length(aa) 624 MW(Da) 69,639 pI 6.39 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.049   Codon Adaptation Index 0.155   Frequency of Optimal Codons 0.439   Hydropathicity of Protein -0.399   Aromaticity Score 0.074

10 20 30 40 50 | | | | | MVVQKKLRAILTDEGVLIKSQSHHMFNKHGQLRSGDSLSLLSCLSCLDDG TLSSDGGSFDEDDSLELLPLNTTIPFNRILNAKYVNVGQKGFNNGKISSN PFQTENLSSSSENDDVENHSLSNDKAPVSESQSFPKKDKWDTKTNTVKVS PDDSQDNSPSLGIKDNQQLIELTFAVPKGHDVIPQKLTLLIDHVSRKSRA NTGEENISSGTVEEILEKSYENSKRNRSILVIINPHGGKGTAKNLFLTKA RPILVESGCKIEIAYTKYARHAIDIAKDLDISKYDTIACASGDGIPYEVI NGLYRRPDRVDAFNKLAVTQLPCGSGNAMSISCHWTNNPSYAALCLVKSI ETRIDLMCCSQPSYMNEWPRLSFLSQTYGVIAESDINTEFIRWMGPVRFN LGVAFNIIQGKKYPCEVFVKYAAKSKKELKVHFLENKDKNKGCLTFEPNP SPNSSPDLLSKNNINNSTKDELSPNFLNEDNFKLKYPMTEPVPRDWEKMD SELTDNLTIFYTGKMPYIAKDTKFFPAALPADGTIDLVITDARIPVTRMT PILLSLDKGSHVLEPEVIHSKILAYKIIPKVESGLFSVDGEKFPLEPLQV EIMPMLCKTLLRNGRYIDTEFESM*

Protein Structures from PDB: proteins of known structure with sequence similarity to LCB4/YOR171C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
LCB4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR171C	SGD Systematic Sequence
854342	NCBI: Gene ID
NP_014814.1	NCBI: RefSeq protein version ID
NP_014814.1	NCBI: RefSeq protein version ID
6324745	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]

DNA & RNA Details Topic Research Highlight Reference Contributor Other DNA & RNA Details Description: Specifically lower expression in carbon limited chemostat cultures versus carbon excess. otherTopic: expression Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74            Viktor Boer 2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
47 curated references; 0 references not yet curated
Disease Gene Related Reviews	Ozbayraktar FB and Ulgen KO (2009) Molecular facets of sphingolipids: mediators of diseases. Biotechnol J 4(7):1028-41	|AUR1 |CSG2 |CSH1 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB5 |SCS7 |SUR1 |SUR2 |TSC10 |MORE
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE
Reviews	Dickson RC (2008) Thematic Review Series: Sphingolipids. New insights into sphingolipid metabolism and function in budding yeast. J Lipid Res 49(5):909-21	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |IFA38 |IPT1 |ISC1 |LCB1 |LCB2 |LCB3 |LCB5 |LIP1 |PHS1 |MORE
Protein Processing/Modification/Regulation	Ren J, et al. (2008) CSS-Palm 2.0: an updated software for palmitoylation sites prediction. Protein Eng Des Sel 21(11):639-44	|AGP1 |AKR1 |ANR2 |BAP2 |BET3 |ENV7 |GAP1 |GNP1 |GPA1 |GPA2 |HIP1 |LSB6 |MEH1 |MLF3 |MORE
Mutants/Phenotypes Strains/Constructs	Tang F, et al. (2008) A life-span extending form of autophagy employs the vacuole-vacuole fusion machinery. Autophagy 4(7):874-86	|ATG1 |ATG10 |ATG11 |ATG15 |ATG17 |ATG22 |ATG7 |ATG8 |AVT3 |AVT4 |ERG2 |ERG28 |ERG5 |ERG6 |MORE
Computational analysis RNA Levels and Processing	Alvarez-Vasquez F, et al. (2007) Coordination of the dynamics of yeast sphingolipid metabolism during the diauxic shift. Theor Biol Med Model 4:42	|AUR1 |DPP1 |ELO1 |FAS1 |FAS2 |FEN1 |GPT2 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB5 |LIP1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Brace JL, et al. (2007) SVF1 regulates cell survival by affecting sphingolipid metabolism in Saccharomyces cerevisiae. Genetics 175(1):65-76	|DPL1 |LCB3 |SUR2 |SVF1 |YPK1
Reviews	Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB5 |SUR1 |SUR4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Daquinag A, et al. (2007) The yeast PH domain proteins Slm1 and Slm2 are targets of sphingolipid signaling during the response to heat stress. Mol Cell Biol 27(2):633-50	|CNA1 |CSG2 |FEN1 |PKH1 |PKH2 |SLM1 |SLM2
Cellular Location Protein Processing/Modification/Regulation	Iwaki S, et al. (2007) Intracellular Trafficking Pathway of Yeast Long-chain Base Kinase Lcb4, from Its Synthesis to Its Degradation. J Biol Chem 282(39):28485-92
Reviews	Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44	|DPL1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB5 |LIP1 |SUR2 |TSC10 |TSC3 |YDC1 |YPC1 |YSR3
Mutants/Phenotypes Strains/Constructs	Lehner KR, et al. (2007) Ninety-Six Haploid Yeast Strains With Individual Disruptions of Open Reading Frames Between YOR097C and YOR192C, Constructed for the Saccharomyces Genome Deletion Project, Have an Additional Mutation in the Mismatch Repair Gene MSH3. Genetics 177(3):1951-3	|ADE2 |AFI1 |ALE1 |ARP8 |AZF1 |BAG7 |CAT5 |CEX1 |CRC1 |DCI1 |DCS2 |DDP1 |EFT1 |ELG1 |MORE
Reviews	Nadolski MJ and Linder ME (2007) Protein lipidation. FEBS J 274(20):5202-5210	|AKR1 |AKR2 |CHS3 |ERF2 |PFA3 |PFA4 |PFA5 |RAS2 |SHR5 |SWF1 |TLG1 |TUL1 |VAC8 |YCK2
Non-Fungal Related Genes/Proteins Reviews	Spiegel S and Milstien S (2007) Functions of the multifaceted family of sphingosine kinases and some close relatives. J Biol Chem 282(4):2125-9	|LCB5
Reviews	Dickson RC, et al. (2006) Functions and metabolism of sphingolipids in Saccharomyces cerevisiae. Prog Lipid Res 45(6):447-65	|ARV1 |AUR1 |CSH1 |DPL1 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB5 |NCR1 |PKH1 |PKH2 |SCS7 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Meier KD, et al. (2006) Sphingoid base is required for translation initiation during heat stress in Saccharomyces cerevisiae. Mol Biol Cell 17(3):1164-75	|EAP1 |HSP26 |LAC1 |LAG1 |LCB1 |LCB5 |MSN2 |PKH1 |PKH2 |SSA1 |UBI4 |YPK1 |YPK2
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |CSG2 |DPL1 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB5 |LIP1 |SUR1 |SUR2 |TSC3 |MORE
Protein Processing/Modification/Regulation	Roth AF, et al. (2006) Global analysis of protein palmitoylation in yeast. Cell 125(5):1003-13	|AGP1 |AKR1 |AKR2 |ANR2 |BAP2 |BAP3 |BET3 |CDC42 |ENV7 |ERF2 |GAP1 |GNP1 |GPA1 |GPA2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Tani M, et al. (2006) Rescue of cell growth by sphingosine with disruption of lipid microdomain formation in Saccharomyces cerevisiae deficient in sphingolipid biosynthesis. Biochem J 394(Pt 1):237-42	|LCB2 |PMA1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Daniel J (2005) Sir-dependent downregulation of various aging processes. Mol Genet Genomics 274(5):539-47	|CDC25 |EMI2 |FHL1 |HXT4 |PEP5 |PFK26 |SIR4 |STM1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
Protein Processing/Modification/Regulation Protein Sequence Features	Iwaki S, et al. (2005) Phosphorylation by Pho85 cyclin-dependent kinase acts as a signal for the down-regulation of the yeast sphingoid long-chain base kinase Lcb4 during the stationary phase. J Biol Chem 280(8):6520-7	|PCL1 |PCL2 |PHO85
Cellular Location Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions	Kihara A, et al. (2005) Long-chain base kinase Lcb4 Is anchored to the membrane through its palmitoylation by Akr1. Mol Cell Biol 25(21):9189-97	|AKR1 |AKR2 |TVP38
RNA Levels and Processing Regulation of	Kleinschmidt M, et al. (2005) Transcriptional profiling of Saccharomyces cerevisiae cells under adhesion-inducing conditions. Mol Genet Genomics 273(5):382-93	|AAD10 |APM3 |ARG1 |ARO10 |BAT2 |BIO3 |BRR2 |CPR6 |CUP1-1 |CUP1-2 |CWP2 |DDR48 |ECM22 |ERG12 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of	Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82	|DPL1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |HAP1 |HEM14 |HMG1 |KES1 |LCB3 |PBP1 |PDR5 |TPS1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kihara A and Igarashi Y (2004) Cross talk between sphingolipids and glycerophospholipids in the establishment of plasma membrane asymmetry. Mol Biol Cell 15(11):4949-59	|DHH1 |DNF1 |DNF2 |LEM3 |PDR1 |PDR10 |PDR12 |PDR15 |PDR18 |PDR3 |PDR5 |RSB1 |SNQ2 |YOR1 |MORE
Non-Fungal Related Genes/Proteins Reviews	Saba JD and Hla T (2004) Point-counterpoint of sphingosine 1-phosphate metabolism. Circ Res 94(6):724-34	|LCB3 |LCB5 |YSR3
Mutants/Phenotypes Strains/Constructs	Welsch CA, et al. (2004) Genetic, biochemical, and transcriptional responses of Saccharomyces cerevisiae to the novel immunomodulator FTY720 largely mimic those of the natural sphingolipid phytosphingosine. J Biol Chem 279(35):36720-31	|BUL2 |CAJ1 |LCB5 |RPL40A |RPL40B |TAT1 |TAT2
Cellular Location Function/Process	Funato K, et al. (2003) Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae. J Biol Chem 278(9):7325-34	|LCB3 |LCB5
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |CSG2 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB5 |SUR1 |SUR2 |TSC10 |YSR3
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86	|DPL1 |LCB3 |LCB5
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |MORE
Cellular Location	Hait NC, et al. (2002) Lcb4p sphingoid base kinase localizes to the Golgi and late endosomes. FEBS Lett 532(1-2):97-102
Function/Process Reviews	Obeid LM, et al. (2002) Yeast sphingolipids: metabolism and biology. Biochim Biophys Acta 1585(2-3):163-71	|CSG2 |FEN1 |LCB5 |SUR1 |SUR2 |SUR4
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Birchwood CJ, et al. (2001) Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation. J Biol Chem 276(15):11712-8	|CCH1 |DPL1 |LCB3 |LCB5 |MID1
Genetic Interactions	Chung N, et al. (2001) Phytosphingosine as a specific inhibitor of growth and nutrient import in Saccharomyces cerevisiae. J Biol Chem 276(38):35614-21	|DPL1 |FEN1 |HIS4 |LCB5 |LEU2 |SUR2 |TRP1
Cell Cycle Phase Involved Function/Process	Jenkins GM and Hannun YA (2001) Role for de novo sphingoid base biosynthesis in the heat-induced transient cell cycle arrest of Saccharomyces cerevisiae. J Biol Chem 276(11):8574-81	|CLN3 |DOA1 |LCB1 |LCB5 |SUR2
Computational analysis	Radivoyevitch T (2001) Sphingoid base metabolism in yeast: mapping gene expression patterns into qualitative metabolite time course predictions. Comp Funct Genomics 2(5):289-94	|AUR1 |DPL1 |FAS1 |FAS2 |FEN1 |LCB1 |LCB2 |LCB5 |SUR4
Function/Process Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs Substrates/Ligands/Cofactors	Zhang X, et al. (2001) Elevation of endogenous sphingolipid long-chain base phosphates kills Saccharomyces cerevisiae cells. Curr Genet 40(4):221-33	|DPL1 |LCB3 |LCB5
Techniques and Reagents	Chung N and Obeid LM (2000) Use of yeast as a model system for studies of sphingolipid metabolism and signaling. Methods Enzymol 311():319-31	|FEN1 |LCB5 |SUR2 |SUR4
Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Kim S, et al. (2000) Accumulation of phosphorylated sphingoid long chain bases results in cell growth inhibition in Saccharomyces cerevisiae. Genetics 156(4):1519-29	|DPL1 |LCB3 |LCB5 |SUR2 |YSR3
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Zanolari B, et al. (2000) Sphingoid base synthesis requirement for endocytosis in Saccharomyces cerevisiae. EMBO J 19(12):2824-33	|ACT1 |LCB1 |LCB3 |LCB5 |SLA2 |YSR3
Function/Process Reviews Substrates/Ligands/Cofactors	Dickson RC and Lester RL (1999) Metabolism and selected functions of sphingolipids in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1438(3):305-21	|AUR1 |CSG2 |DPL1 |ERG2 |FAS2 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB5 |MSN2 |MSN4 |MSS4 |MORE
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Nagiec MM, et al. (1998) The LCB4 (YOR171c) and LCB5 (YLR260w) genes of Saccharomyces encode sphingoid long chain base kinases. J Biol Chem 273(31):19437-42	|LCB5
DNA/RNA Sequence Features Mapping	Madania A, et al. (1996) Analysis of a 22,956 bp region on the right arm of Saccharomyces cerevisiae chromosome XV. Yeast 12(15):1563-73	|ALE1 |GLN4 |MED4 |SEY1

Return to SGD

Send a Message to the SGD Curators