---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP1/YOR098C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 511179 to 507949 CDS: 511179 - 507949 Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP1	YOR098C		ORF, Verified	S000005624
Description
Nuclear pore complex (NPC) subunit, involved in protein import/export and in export of RNAs, possible karyopherin release factor that accelerates release of karyopherin-cargo complexes after transport across NPC; potential Cdc28p substrate

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52          IPI : Inferred from Physical Interaction with SGD:SAC3 Assigned on 2003-06-05 SGD structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD RNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47          IMP : Inferred from Mutant Phenotype Assigned on 2006-06-17 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear envelope organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT nucleocytoplasmic transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein complex assembly Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47          IMP : Inferred from Mutant Phenotype Assigned on 2006-06-17 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal subunit export from nucleus Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Davis LI and Fink GR (1990) The NUP1 gene encodes an essential component of the yeast nuclear pore complex. Cell 61(6):965-78        IDA : Inferred from Direct Assay Assigned on 2003-09-29 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP1/YOR098C for NUP1 NUP1 encodes a nuclear pore protein (nucleoporin) that was first identified by cross-reaction with antibodies raised against rat liver nucleoporins (1). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). Nup1p is one of a group of nucleoporins that contain multiple repeats of the amino acids FXFG (1, 3, 2). Mutations in NUP1 cause defects in both protein import into and mRNA export out of the nucleus, as well as invaginations of the nuclear envelope (15, 2, 3). Davis and Fink (1) report that a NUP1 deletion is inviable, whereas others (16, 17) report that a NUP1 deletion is viable. The difference is attributed the difference to a naturally occurring suppressor present in some strains (16). Several other nucleoporin genes have been identified in yeast by screening for mutations that are synthetically lethal with conditional nup1 mutations (18, 2, 3, 12). NUP1 shows genetic interactions with SRP1, which encodes a nuclear import factor (16, 2, 3), and with ARP2 (19). Last Updated: 1999-07-26

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP1/YOR098C for NUP1 1) Davis LI and Fink GR (1990) The NUP1 gene encodes an essential component of the yeast nuclear pore complex. Cell 61(6):965-78        2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Bogerd AM, et al. (1994) nup1 mutants exhibit pleiotropic defects in nuclear pore complex function. J Cell Biol 127(2):319-32      16) Belanger KD, et al. (1994) Genetic and physical interactions between Srp1p and nuclear pore complex proteins Nup1p and Nup2p. J Cell Biol 126(3):619-30      17) Schlaich NL and Hurt EC (1995) Analysis of nucleocytoplasmic transport and nuclear envelope structure in yeast disrupted for the gene encoding the nuclear pore protein Nup1p. Eur J Cell Biol 67(1):8-14      18) Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36        19) Yan C, et al. (1997) A role for the divergent actin gene, ACT2, in nuclear pore structure and function. EMBO J 16(12):3572-86        20) Gilchrist D, et al. (2002) Accelerating the rate of disassembly of karyopherin.cargo complexes. J Biol Chem 277(20):18161-72

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP1/YOR098C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP1/YOR098C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSSNTSS C-term RMRHSKR Length(aa) 1,076 MW(Da) 113,581 pI 10.42 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.024   Codon Adaptation Index 0.121   Frequency of Optimal Codons 0.415   Hydropathicity of Protein -0.796   Aromaticity Score 0.072

10 20 30 40 50 | | | | | MSSNTSSVMSSPRVEKRSFSSTLKSFFTNPNKKRPSSKKVFSSNLSYANH LEESDVEDTLHVNKRKRVSGTSQHSDSLTQNNNNAPIIIYGTENTERPPL LPILPIQRLRLLREKQRVRNMRELGLIQSTEFPSITSSVILGSQSKSDEG GSYLCTSSTPSPIKNGSCTRQLAGKSGEDTNVGLPILKSLKNRSNRKRFH SQSKGTVWSANFEYDLSEYDAIQKKDNKDKEGNAGGDQKTSENRNNIKSS ISNGNLATGPNLTSEIEDLRADINSNRLSNPQKNLLLKGPASTVAKTAPI QESFVPNSERSGTPTLKKNIEPKKDKESIVLPTVGFDFIKDNETPSKKTS PKATSSAGAVFKSSVEMGKTDKSTKTAEAPTLSFNFSQKANKTKAVDNTV PSTTLFNFGGKSDTVTSASQPFKFGKTSEKSENHTESDAPPKSTAPIFSF GKQEENGDEGDDENEPKRKRRLPVSEDTNTKPLFDFGKTGDQKETKKGES EKDASGKPSFVFGASDKQAEGTPLFTFGKKADVTSNIDSSAQFTFGKAAT AKETHTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPTFSFSKSEEER KSSPISNEAAKPSFSFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVS EPKKPSFTFASSKTSQPKPLFSFGKSDAAKEPPGSNTSFSFTKPPANETD KRPTPPSFTFGGSTTNNTTTTSTKPSFSFGAPESMKSTASTAAANTEKLS NGFSFTKFNHNKEKSNSPTSFFDGSASSTPIPVLGKPTDATGNTTSKSAF SFGTANTNGTNASANSTSFSFNAPATGNGTTTTSNTSGTNIAGTFNVGKP DQSIASGNTNGAGSAFGFSSSGTAATGAASNQSSFNFGNNGAGGLNPFTS ATSSTNANAGLFNKPPSTNAQNVNVPSAFNFTGNNSTPGGGSVFNMNGNT NANTVFAGSNNQPHQSQTPSFNTNSSFTPSTVPNINFSGLNGGITNTATN ALRPSDIFGANAASGSNSNVTNPSSIFGGAGGVPTTSFGQPQSAPNQMGM GTNNGMSMGGGVMANRKIARMRHSKR*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP1/YOR098C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP1 Homolog Source (per PDB) Protein Alignment: NUP1 vs. Homolog External Links P-Value %Identical %Similar Alignment 2bpt ( Chain: B) Structure of the nup1p:kap95p complex PDB_Info PDB_Structure Saccharomyces cerevisiae 2.5e-08 100 0 View alignment SCOP MMDB CATH 3hoy ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2nvz ( Chain: A) Rna polymerase ii elongation complex with utp, updated 11/2006 PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2ja6 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex b PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtm ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 3how ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2ja7 ( Chain: A, M) Cpd lesion containing rna polymerase ii elongation complex c PDB_Info PDB_Structure Saccharomyces cerevisiae Chain A = 0.000710 23 28 View alignment SCOP MMDB CATH Chain M = 0.000710 23 28 View alignment 2ja5 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex a PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3hoz ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2nvx ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with 2'- dutp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtk ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 3hov ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2nvy ( Chain: A) Rna polymerase ii form ii in 150 mm mn+2 PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1i3q ( Chain: A) Rna polymerase ii crystal form i at 3.1 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2vum ( Chain: A) Alpha-amanitin inhibited complete rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1nik ( Chain: A) Wild type rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2nvt ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtl ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 1twg ( Chain: A) Rna polymerase ii complexed with ctp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3i4n ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2nvq ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1twa ( Chain: A) Rna polymerase ii complexed with atp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1y1y ( Chain: A) Rna polymerase ii-tfiis-dna/rna complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtp ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 3gto ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 1r9s ( Chain: A) Rna polymerase ii strand separated elongation complex, matched nucleotide PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1twc ( Chain: A) Rna polymerase ii complexed with gtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3cqz ( Chain: A) Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1r9t ( Chain: A) Rna polymerase ii strand separated elongation complex, mismatched nucleotide PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1twf ( Chain: A) Rna polymerase ii complexed with utp at 2.3 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtq ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 1y77 ( Chain: A) Complete rna polymerase ii elongation complex with substrate analogue gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1r5u ( Chain: A) Rna polymerase ii tfiib complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1wcm ( Chain: A) Complete 12-subunit rna polymerase ii at 3.8 ang PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3fki ( Chain: A) -subunit rna polymerase ii refined with zn-sad data PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2e2h ( Chain: A) Rna polymerase ii elongation complex at 5 mm mg2+ with gtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2e2j ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2ja8 ( Chain: A) Cpd lesion containing rna polymerase ii elongation complex d PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1k83 ( Chain: A) Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2r7z ( Chain: A) Cisplatin lesion containing rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1i50 ( Chain: A) Rna polymerase ii crystal form ii at 2.8 a resolution PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3hou ( Chain: A, M) DNA-directed RNA polym PDB_Info PDB_Structure Unknown Chain A = 0.000710 23 28 View alignment SCOP MMDB CATH Chain M = 0.000710 23 28 View alignment 1twh ( Chain: A) Rna polymerase ii complexed with 2'datp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2yu9 ( Chain: A) Rna polymerase ii elongation complex in 150 mm mg+2 with utp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2r93 ( Chain: A) Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2b63 ( Chain: A) Complete rna polymerase ii-rna inhibitor complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1nt9 ( Chain: A) Complete 12-subunit rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1pqv ( Chain: A) Rna polymerase ii-tfiis complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3h3v ( Chain: B) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2e2i ( Chain: A) Rna polymerase ii elongation complex in 5 mm mg+2 with 2'- dgtp PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3i4m ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 3gtj ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 2r92 ( Chain: A) Elongation complex of rna polymerase ii with artificial rdrp scaffold PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 2b8k ( Chain: A) -subunit rna polymerase ii PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1i6h ( Chain: A) Rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3hox ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 1sfo ( Chain: A) Rna polymerase ii strand separated elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1y1v ( Chain: A) Refined rna polymerase ii-tfiis complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 3gtg ( Chain: A) DNA-directed RNA polym PDB_Info PDB_Structure Unknown 0.000710 23 28 View alignment SCOP MMDB CATH 1y1w ( Chain: A) Complete rna polymerase ii elongation complex PDB_Info PDB_Structure Saccharomyces cerevisiae 0.000710 23 28 View alignment SCOP MMDB CATH 1o6o ( Chain: D, F, E) Importin beta aa1-442 bound to five fxfg repeats from yeast nsp1p. second crystal form PDB_Info PDB_Structure Homo sapiens | Saccharomyces cerevisiae Chain D = 0.001200 34 29 View alignment SCOP MMDB CATH Chain F = 0.001200 34 29 View alignment Chain E = 0.001200 34 29 View alignment 3h0g ( Chain: A, M) DNA-directed RNA polym PDB_Info PDB_Structure Unknown Chain A = 0.004700 25 29 View alignment SCOP MMDB CATH Chain M = 0.004700 25 29 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP1	SGD (2007) Information without a citation in SGD

Mapping Notes

Date	Note
1992-10-01	Edition 11: nup1 is proximal to ade2 based on a three-point cross involving his3 Mortimer RK, et al. (1992) Genetic and physical maps of Saccharomyces cerevisiae, Edition 11. Yeast 8(10):817-902

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR098C	SGD Systematic Sequence
854265	NCBI: Gene ID
NP_014741.1	NCBI: RefSeq protein version ID
NP_014741.1	NCBI: RefSeq protein version ID
6324672	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
Protein Details Topic Research Highlight Reference Contributor Protein Modification Description: Identified as an efficient substrate of Clb2-Cdk1-as1 in a screen of a proteomic GST-fusion library. Modification Type: Phosphorylation Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          Jeff Ubersax 2004-01-29

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
65 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8	|GLE2 |INO1 |MLP2 |NUP157 |NUP2 |NUP60 |SAC3 |SUS1 |THP1 |TSA2
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |NUP188 |MORE
Non-Fungal Related Genes/Proteins	Lu Q, et al. (2010) Arabidopsis homolog of the yeast TREX-2 mRNA export complex: components and anchoring nucleoporin. Plant J 61(2):259-70	|CDC31 |SAC3 |SEM1 |SUS1 |THP1
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs Techniques and Reagents	Belanger KD (2009) Using affinity chromatography to investigate novel protein-protein interactions in an undergraduate cell and molecular biology lab course. CBE Life Sci Educ 8(3):214-25	|MEX67
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Cellular Location Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP82 |POM152 |POM34
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP100 |NUP133 |NUP157 |NUP159 |NUP170 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Harper NC, et al. (2008) Mutations affecting spindle pole body and mitotic exit network function are synthetically lethal with a deletion of the nucleoporin NUP1 in S. cerevisiae. Curr Genet 53(2):95-105	|BFA1 |BUB2 |DBF2 |LTE1 |NIC96 |NSP1 |NUD1 |NUP170 |NUP60 |SWI5
Protein-protein Interactions	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP53 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Evolution Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP100 |NUP116 |NUP159 |NUP2 |NUP42 |NUP49 |NUP53 |NUP57 |NUP60
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Mutants/Phenotypes Strains/Constructs	Lehner KR, et al. (2007) Ninety-Six Haploid Yeast Strains With Individual Disruptions of Open Reading Frames Between YOR097C and YOR192C, Constructed for the Saccharomyces Genome Deletion Project, Have an Additional Mutation in the Mismatch Repair Gene MSH3. Genetics 177(3):1951-3	|ADE2 |AFI1 |ALE1 |ARP8 |AZF1 |BAG7 |CAT5 |CEX1 |CRC1 |DCI1 |DCS2 |DDP1 |EFT1 |ELG1 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Cross-species Expression Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Sistla S, et al. (2007) Multiple conserved domains of the nucleoporin nup124p and its orthologs nup1p and nup153 are critical for nuclear import and activity of the fission yeast tf1 retrotransposon. Mol Biol Cell 18(9):3692-708
Protein Processing/Modification/Regulation Regulation of	Smolka MB, et al. (2007) Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Proc Natl Acad Sci U S A 104(25):10364-9	|CEP3 |CPR5 |CTF4 |DEF1 |DUN1 |EXO1 |HPC2 |ITC1 |MEC1 |MLP1 |NET1 |NPL3 |NSP1 |NUP2 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP100 |NUP116 |NUP145 |NUP2 |NUP49 |NUP57 |NUP60 |PSE1
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Cabal GG, et al. (2006) SAGA interacting factors confine sub-diffusion of transcribed genes to the nuclear envelope. Nature 441(7094):770-3	|ADA2 |GAL1 |GAL10 |GAL7 |SAC3 |SUS1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Mutants/Phenotypes	Sopko R, et al. (2006) Mapping pathways and phenotypes by systematic gene overexpression. Mol Cell 21(3):319-30	|BIK1 |BSP1 |CRZ1 |ENT2 |GIC2 |IQG1 |KIN3 |MET4 |PHO80 |PHO85 |SCO2 |SHE1 |SHS1 |SNC1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47	|ALG12 |NIC96 |NUP116 |NUP82 |POM152
Protein-protein Interactions Strains/Constructs	Hodges JL, et al. (2005) Nuclear import of TFIIB is mediated by Kap114p, a karyopherin with multiple cargo-binding domains. Mol Biol Cell 16(7):3200-10	|GSP1 |HTA1 |HTA2 |HTB2 |KAP114 |NAP1 |SPT15 |SUA7
Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Liu SM and Stewart M (2005) Structural basis for the high-affinity binding of nucleoporin Nup1p to the Saccharomyces cerevisiae importin-beta homologue, Kap95p. J Mol Biol 349(3):515-25	|KAP95
Non-Fungal Related Genes/Proteins Protein Processing/Modification/Regulation	Mason DA, et al. (2005) Increased nuclear envelope permeability and Pep4p-dependent degradation of nucleoporins during hydrogen peroxide-induced cell death. FEMS Yeast Res 5(12):1237-51	|MCA1 |NSP1 |NUP100 |NUP116 |NUP159 |NUP53 |NUP84 |NUP85 |PAI3 |PEP4 |POM152 |PRB1 |SEH1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2004) The karyopherin Msn5/Kap142 requires Nup82 for nuclear export and performs a function distinct from translocation in RPA protein import. J Biol Chem 279(42):43530-9	|KAP123 |KAP95 |MSN5 |NUP82 |PHO4 |PSE1 |RFA2
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Pyhtila B and Rexach M (2003) A gradient of affinity for the karyopherin Kap95p along the yeast nuclear pore complex. J Biol Chem 278(43):42699-709	|GSP1 |KAP95 |NUP100 |NUP42 |SRP1
Protein Processing/Modification/Regulation Regulation of	Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64	|ACE2 |ACF4 |ACM1 |ADY3 |ALY2 |ARG1 |ASE1 |ASH1 |ATG20 |AXL2 |BBP1 |BCK2 |BEM1 |BEM3 |MORE
Function/Process	Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52	|MEX67 |MTR2 |SAC3 |SUB2 |THP1 |YRA1
Function/Process Protein-protein Interactions	Gilchrist D, et al. (2002) Accelerating the rate of disassembly of karyopherin.cargo complexes. J Biol Chem 277(20):18161-72	|CSE1 |GSP1 |KAP95 |NUP2 |SRP1
Function/Process Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2001) Proteomic analysis of nucleoporin interacting proteins. J Biol Chem 276(31):29268-74	|GSP1 |KAP95 |NUP100 |NUP116 |NUP2 |NUP42 |NUP49 |NUP57 |NUP60 |NUP84 |SRP1
Cellular Location Function/Process Protein-protein Interactions	Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50	|GSP1 |KAP123 |KAP95 |NUP2 |NUP60 |SRM1 |SRP1
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |MORE
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Hood JK, et al. (2000) Nup2p is located on the nuclear side of the nuclear pore complex and coordinates Srp1p/importin-alpha export. J Cell Sci 113 ( Pt 8):1471-80	|CSE1 |NUP2 |SRP1
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Function/Process Fungal Related Genes/Proteins	Solsbacher J, et al. (2000) Nup2p, a yeast nucleoporin, functions in bidirectional transport of importin alpha. Mol Cell Biol 20(22):8468-79	|CSE1 |GSP1 |KAP95 |NUP2 |SRP1
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Other Features	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GLE2 |GSP1 |KAP95 |NSP1 |NUP116 |NUP145 |NUP159 |NUP82 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions	Titov AA and Blobel G (1999) The karyopherin Kap122p/Pdr6p imports both subunits of the transcription factor IIA into the nucleus. J Cell Biol 147(2):235-46	|KAP122 |NUP2 |TOA1 |TOA2
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Function/Process Protein-protein Interactions	Floer M, et al. (1997) Disassembly of RanGTP-karyopherin beta complex, an intermediate in nuclear protein import. J Biol Chem 272(31):19538-46	|GSP1 |KAP95 |RNA1 |SRM1 |SRP1 |YRB1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Geiser JR, et al. (1997) Saccharomyces cerevisiae genes required in the absence of the CIN8-encoded spindle motor act in functionally diverse mitotic pathways. Mol Biol Cell 8(6):1035-50	|ARP1 |BIK1 |BUB1 |BUB2 |BUB3 |CDC20 |CIN1 |CIN8 |DYN1 |JNM1 |KIP1 |MPS1 |NIP100 |PAC1 |MORE
Protein-protein Interactions	Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811	|GLE2 |GSP1 |KAP95 |NUP100 |NUP116 |SRP1
Alias DNA/RNA Sequence Features Mapping	Voss H, et al. (1997) DNA sequencing and analysis of 130 kb from yeast chromosome XV. Yeast 13(7):655-72	|ADE2 |AFI1 |ARF3 |ARP8 |AZF1 |BAG7 |CAT5 |CEX1 |CMR2 |CRC1 |ECM3 |EFT1 |ELG1 |GCY1 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Genetic Interactions	Yan C, et al. (1997) A role for the divergent actin gene, ACT2, in nuclear pore structure and function. EMBO J 16(12):3572-86	|ACT1 |ARP2 |SRP1
Genetic Interactions	Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36	|NUP157 |NUP170 |NUP2 |NUP82 |RNA1 |SRP1 |YRB1
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301	|NSP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP49 |NUP85
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Protein-protein Interactions	Rexach M and Blobel G (1995) Protein import into nuclei: association and dissociation reactions involving transport substrate, transport factors, and nucleoporins. Cell 83(5):683-92	|GSP1 |KAP95 |NUP145 |NUP2 |NUP57 |SRP1
Cellular Location	Rose AM, et al. (1995) Location of N2,N2-dimethylguanosine-specific tRNA methyltransferase. Biochimie 77(1-2):45-53	|TRL1 |TRM1
Mutants/Phenotypes Strains/Constructs	Schlaich NL and Hurt EC (1995) Analysis of nucleocytoplasmic transport and nuclear envelope structure in yeast disrupted for the gene encoding the nuclear pore protein Nup1p. Eur J Cell Biol 67(1):8-14	|NSP1
Genetic Interactions Protein-protein Interactions	Belanger KD, et al. (1994) Genetic and physical interactions between Srp1p and nuclear pore complex proteins Nup1p and Nup2p. J Cell Biol 126(3):619-30	|NUP2 |SRP1
Cellular Location Function/Process Mutants/Phenotypes	Bogerd AM, et al. (1994) nup1 mutants exhibit pleiotropic defects in nuclear pore complex function. J Cell Biol 127(2):319-32
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Loeb JD, et al. (1993) NUP2, a novel yeast nucleoporin, has functional overlap with other proteins of the nuclear pore complex. Mol Biol Cell 4(2):209-22	|NSP1 |NUP2
Cellular Location Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs Techniques and Reagents	Davis LI and Fink GR (1990) The NUP1 gene encodes an essential component of the yeast nuclear pore complex. Cell 61(6):965-78	|NSP1

Return to SGD

Send a Message to the SGD Curators