---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

OST3/YOR085W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 482035 to 483087 CDS: 482035 - 483087 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
OST3	YOR085W		ORF, Verified	S000005611
Description
Gamma subunit of the oligosaccharyltransferase complex of the ER lumen, which catalyzes asparagine-linked glycosylation of newly synthesized proteins; Ost3p is important for N-glycosylation of a subset of proteins

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl-diphosphooligosaccharide-protein glycotransferase activity Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2002-10-01 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.119 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT glycoprotein metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein amino acid N-linked glycosylation Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2002-10-01 SGD protein amino acid glycosylation Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein complex assembly Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56        IMP : Inferred from Mutant Phenotype Assigned on 2002-11-04 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB oligosaccharyltransferase complex Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2005-05-04 SGD Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56        IPI : Inferred from Physical Interaction Assigned on 2002-03-28 SGD Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8        IPI : Inferred from Physical Interaction Assigned on 2006-02-03 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for OST3/YOR085W for OST3 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). The oligosaccharyl transferase complex (OST complex) (EC 2.4.1.119) transfers 14-sugar branched oligosaccharides from dolichyl pyrophosphate to asparagine residues. The complex contains nine protein subunits: Ost1p, Ost2p, Ost3p, Ost4p, Ost5p, Ost6p, Stt3p, Swp1p, and Wbp1p, all of which are integral membrane proteins of the ER. The OST complex interacts with the Sec61p pore complex (3) involved in protein import into the ER. Ost3p is the gamma subunit (4) of the OST complex, one of the original six subunits purified (5). Ost3p is homologous to Ost6p (6), and several lines of evidence indicate that they are alternative members of the OST complex. Both proteins are present in the complex at substoichiometric levels. They interact with the same subset of OST complex proteins, and are not co-immunoprecipitated (7). Disruption of either OST3 or OST6 causes only a minor defect in N-glycosylation (8), but deletion of both causes severe underglycosylation of soluble and membrane-bound glycoproteins and a defect in OST complex formation, although this does not result in a growth defect (6). Although Ost3p and Ost6p share low sequence identity, they have very similar hydropathy profiles (6). They are homologous to the human tumor suppressor N33 (OMIM) (6). One difference between them: ost6 mutants are sensitive to caffeine, SDS, and Calcofluor White--indicating a possible defect in cell wall biogenesis--while ost3 mutants are not (6). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forOST3/YOR085W for OST3 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24        4) Knauer R and Lehle L (1994) The N-oligosaccharyltransferase complex from yeast. FEBS Lett 344(1):83-6      5) Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17      6) Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56        7) Yan A, et al. (2003) New findings on interactions among the yeast oligosaccharyl transferase subunits using a chemical cross-linker. J Biol Chem 278(35):33078-87        8) Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77      9) Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from yeast. Biochim Biophys Acta 1426(2):259-73

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for OST3/YOR085W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for OST3/YOR085W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MNWLFLV C-term RLSAPFK Length(aa) 350 MW(Da) 39,483 pI 8.61 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.217   Codon Adaptation Index 0.186   Frequency of Optimal Codons 0.543   Hydropathicity of Protein 0.403   Aromaticity Score 0.131	10 20 30 40 50 | | | | | MNWLFLVSLVFFCGVSTHPALAMSSNRLLKLANKSPKKIIPLKDSSFENI LAPPHENAYIVALFTATAPEIGCSLCLELESEYDTIVASWFDDHPDAKSS NSDTSIFFTKVNLEDPSKTIPKAFQFFQLNNVPRLFIFKPNSPSILDHSV ISISTDTGSERMKQIIQAIKQFSQVNDFSLHLPMDWTPIITSTIITFITV LLFKKQSKLMFSIISSRIIWATLSTFFIICMISAYMFNQIRNTQLAGVGP KGEVMYFLPNEFQHQFAIETQVMVLIYGTLAALVVVLVKGIQFLRSHLYP ETKKAYFIDAILASFCALFIYVFFAALTTVFTIKSPAYPFPLLRLSAPFK *

Protein Structures from PDB: proteins of known structure with sequence similarity to OST3/YOR085W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
OST3	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR085W	SGD Systematic Sequence
854252	NCBI: Gene ID
NP_014728.1	NCBI: RefSeq protein version ID
NP_014728.1	NCBI: RefSeq protein version ID
6324659	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
55 curated references; 0 references not yet curated
DNA/RNA Sequence Features Fungal Related Genes/Proteins	Gordon JL, et al. (2009) Additions, losses, and rearrangements on the evolutionary route from a reconstructed ancestor to the modern Saccharomyces cerevisiae genome. PLoS Genet 5(5):e1000485	|ABM1 |ADH1 |ADH2 |ARI1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |AUS1 |AXL2 |AZR1 |CCT2 |DAL4 |DAL7 |MORE
Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Harada Y, et al. (2009) Oligosaccharyltransferase directly binds to ribosome at a location near the translocon-binding site. Proc Natl Acad Sci U S A 106(17):6945-9	|NIP7 |NMD3 |OST1 |OST2 |OST4 |OST5 |OST6 |RDN25-1 |RDN25-2 |RDN5-1 |RDN5-2 |RDN5-3 |RDN5-4 |RDN5-5 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Schulz BL and Aebi M (2009) Analysis of glycosylation site occupancy reveals a role for Ost3p and Ost6p in site-specific N-glycosylation efficiency. Mol Cell Proteomics 8(2):357-64	|CWP1 |ECM33 |GAS5 |OST6 |UTR2
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Schulz BL, et al. (2009) Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency. Proc Natl Acad Sci U S A 106(27):11061-6	|OST6
Large-scale phenotype analysis	Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508	|AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Mutants/Phenotypes	Watanabe M, et al. (2009) Comprehensive and quantitative analysis of yeast deletion mutants defective in apical and isotropic bud growth. Curr Genet 55(4):365-80	|ACT1 |ADA2 |AKR1 |ARC18 |ARP5 |ARP6 |ARP8 |ASF1 |BNR1 |BUD13 |BUD4 |CCR4 |CDC73 |CLB2 |MORE
Computational analysis Large-scale protein interaction	Wu M, et al. (2009) A core-attachment based method to detect protein complexes in PPI networks. BMC Bioinformatics 10:169	|DAD1 |DAM1 |GPI2 |HAP2 |HAP3 |HAP5 |MTH1 |OST1 |OST2 |OST4 |OST5 |OST6 |PEP3 |PEP5 |MORE
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |MORE
Substrates/Ligands/Cofactors	Hogan DJ, et al. (2008) Diverse RNA-binding proteins interact with functionally related sets of RNAs, suggesting an extensive regulatory system. PLoS Biol 6(10):e255	|ACO1 |BFR1 |BUD27 |CBC2 |CBF5 |CLB2 |CLN2 |CLN3 |CPA1 |DHH1 |GBP2 |GCN4 |GIC1 |GIC2 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Krause SA, et al. (2008) The synthetic genetic network around PKC1 identifies novel modulators and components of protein kinase C signaling in Saccharomyces cerevisiae. Eukaryot Cell 7(11):1880-7	|ACK1 |API2 |ATG15 |BCK1 |BNI1 |CHL1 |CIK1 |CSF1 |CTF19 |EGD1 |JNM1 |LAS21 |MID1 |MIG1 |MORE
Mutants/Phenotypes	Loukin S, et al. (2008) A genome-wide survey suggests an osmoprotective role for vacuolar Ca2+ release in cell wall-compromised yeast. FASEB J 22(7):2405-15	|ALG5 |ALG6 |ALG8 |BST1 |CSF1 |DIE2 |GAS1 |GDA1 |GUP1 |HHY1 |HUR1 |KRE1 |KRE6 |LAS21 |MORE
Function/Process	Pu S, et al. (2008) Local coherence in genetic interaction patterns reveals prevalent functional versatility. Bioinformatics 24(20):2376-83	|ASF1 |BRE1 |CDC73 |CTF18 |CTF4 |CTF8 |ELP2 |ELP3 |ELP4 |ELP6 |IRE1 |LGE1 |MMS1 |MMS22 |MORE
Function/Process Non-Fungal Related Genes/Proteins Protein Physical Properties Substrates/Ligands/Cofactors	Kelleher DJ, et al. (2007) Dolichol-linked oligosaccharide selection by the oligosaccharyltransferase in protist and fungal organisms. J Cell Biol 177(1):29-37	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Kohda D, et al. (2007) New oligosaccharyltransferase assay method. Glycobiology 17(11):1175-82	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Lennarz WJ (2007) Studies on oligosaccharyl transferase in yeast. Acta Biochim Pol 54(4):673-7	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Cellular Location Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Techniques and Reagents	Chavan M, et al. (2006) Dimeric organization of the yeast oligosaccharyl transferase complex. Proc Natl Acad Sci U S A 103(24):8947-52	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Kelleher DJ and Gilmore R (2006) An evolving view of the eukaryotic oligosaccharyltransferase. Glycobiology 16(4):47R-62R	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Reviews	Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R	|ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST1 |OST2 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Mutants/Phenotypes Strains/Constructs	Wheeler RT and Fink GR (2006) A drug-sensitive genetic network masks fungi from the immune system. PLoS Pathog 2(4):e35	|AIM44 |ASF1 |DIA2 |GAS1 |IES6 |LAP2 |MNN10 |MNN11 |MOT2 |OCH1 |OST4 |RDS2 |SLA1 |SLT2 |MORE
Function/Process Protein-protein Interactions Strains/Constructs	Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24	|OST1 |OST2 |OST4 |OST5 |OST6 |SBH1 |SEC61 |SSS1 |STT3 |SWP1 |WBP1
Mutants/Phenotypes	Chen Y, et al. (2005) Identification of mitogen-activated protein kinase signaling pathways that confer resistance to endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Cancer Res 3(12):669-77	|ALG3 |ALG8 |ALG9 |ARD1 |BCK1 |CMR2 |CNB1 |DAL81 |DID2 |EDE1 |ERV25 |FPS1 |FYV8 |HAC1 |MORE
DNA/RNA Sequence Features	Duttagupta R, et al. (2005) Global analysis of Pub1p targets reveals a coordinate control of gene expression through modulation of binding and stability. Mol Cell Biol 25(13):5499-513	|ANT1 |APM1 |BGL2 |DED1 |FZO1 |GCN4 |HYP2 |MRH1 |PAB1 |PCL5 |PRB1 |PUB1 |RPL14B |RPL17A |MORE
Reviews	Jones J, et al. (2005) Controlling N-linked glycan site occupancy. Biochim Biophys Acta 1726(2):121-37	|MNL1 |OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
DNA/RNA Sequence Features Non-Fungal Related Genes/Proteins	Shibatani T, et al. (2005) Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits. Biochemistry 44(16):5982-92	|OST6
Function/Process Protein-protein Interactions	Spirig U, et al. (2005) The 3.4-kDa Ost4 protein is required for the assembly of two distinct oligosaccharyltransferase complexes in yeast. Glycobiology 15(12):1396-406	|OST1 |OST4 |OST6 |STT3 |SWP1 |WBP1
Protein-protein Interactions Strains/Constructs	Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15	|ALG1 |OST1 |OST2 |OST4 |OST5 |OST6 |SBH1 |SBH2 |SWP1 |WBP1
Reviews	Yan A and Lennarz WJ (2005) Unraveling the mechanism of protein N-glycosylation. J Biol Chem 280(5):3121-4	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Cellular Location Protein Sequence Features Techniques and Reagents	Yan A, et al. (2005) Studies of yeast oligosaccharyl transferase subunits using the split-ubiquitin system: topological features and in vivo interactions. Proc Natl Acad Sci U S A 102(20):7121-6	|OST2 |OST5 |OST6 |STT3 |SWP1
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Non-Fungal Related Genes/Proteins	Kelleher DJ, et al. (2003) Oligosaccharyltransferase isoforms that contain different catalytic STT3 subunits have distinct enzymatic properties. Mol Cell 12(1):101-11	|STT3
Protein-protein Interactions	Kim H, et al. (2003) Determination of the membrane topology of Ost4p and its subunit interactions in the oligosaccharyltransferase complex in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 100(13):7460-4	|OST4 |STT3
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Yan A, et al. (2003) New findings on interactions among the yeast oligosaccharyl transferase subunits using a chemical cross-linker. J Biol Chem 278(35):33078-87	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Substrates/Ligands/Cofactors	Yan Q and Lennarz WJ (2002) Studies on the function of oligosaccharyl transferase subunits. Stt3p is directly involved in the glycosylation process. J Biol Chem 277(49):47692-700	|OST1 |STT3
Other Features Protein/Nucleic Acid Structure	Fetrow JS, et al. (2001) Genomic-scale comparison of sequence- and structure-based methods of function prediction: does structure provide additional insight? Protein Sci 10(5):1005-14	|CDD1 |EPS1 |ERF2 |EUG1 |GRX1 |GRX2 |GRX3 |GRX4 |GRX5 |GRX6 |GRX7 |GRX8 |LEU5 |MPD1 |MORE
Cellular Location Function/Process Protein-protein Interactions	Kim H, et al. (2000) Studies on the role of the hydrophobic domain of Ost4p in interactions with other subunits of yeast oligosaccharyl transferase. Proc Natl Acad Sci U S A 97(4):1516-20	|OST4 |STT3
Protein-protein Interactions	Park H and Lennarz WJ (2000) Evidence for interaction of yeast protein kinase C with several subunits of oligosaccharyl transferase. Glycobiology 10(7):737-44	|OST1 |PKC1 |STT3 |SWP1 |WBP1
Non-Fungal Related Genes/Proteins Substrates/Ligands/Cofactors Techniques and Reagents	Eason PD and Imperiali B (1999) A potent oligosaccharyl transferase inhibitor that crosses the intracellular endoplasmic reticulum membrane. Biochemistry 38(17):5430-7	|SWP1 |WBP1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from yeast. Biochim Biophys Acta 1426(2):259-73	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33	|JEM1 |KAR2 |OST1 |SCJ1 |SEC63
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs Techniques and Reagents	Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20	|OST1 |OST2 |OST4 |OST5 |STT3 |SWP1 |WBP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Reiss G, et al. (1997) A specific screen for oligosaccharyltransferase mutations identifies the 9 kDa OST5 protein required for optimal activity in vivo and in vitro. EMBO J 16(6):1164-72	|OST1 |OST2 |OST5 |STT3 |SWP1 |WBP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Spirig U, et al. (1997) The STT3 protein is a component of the yeast oligosaccharyltransferase complex. Mol Gen Genet 256(6):628-37	|OST1 |OST4 |STT3 |SWP1 |WBP1
Alias DNA/RNA Sequence Features Mapping	Voss H, et al. (1997) DNA sequencing and analysis of 130 kb from yeast chromosome XV. Yeast 13(7):655-72	|ADE2 |AFI1 |ARF3 |ARP8 |AZF1 |BAG7 |CAT5 |CEX1 |CMR2 |CRC1 |ECM3 |EFT1 |ELG1 |GCY1 |MORE
Non-Fungal Related Genes/Proteins	MacGrogan D, et al. (1996) Structure and methylation-associated silencing of a gene within a homozygously deleted region of human chromosome band 8p22. Genomics 35(1):55-65
Reviews	Silberstein S and Gilmore R (1996) Biochemistry, molecular biology, and genetics of the oligosaccharyltransferase. FASEB J 10(8):849-58	|OST1 |OST2 |OST4 |OST5 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77	|ALG5 |OST1 |SWP1 |WBP1
Cellular Location Function/Process	Silberstein S, et al. (1995) The essential OST2 gene encodes the 16-kD subunit of the yeast oligosaccharyltransferase, a highly conserved protein expressed in diverse eukaryotic organisms. J Cell Biol 131(2):371-83	|OST1 |OST2 |SWP1 |WBP1
Cellular Location Protein Physical Properties Techniques and Reagents	Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17	|OST1 |OST2 |OST5 |SWP1 |WBP1
Alias Substrates/Ligands/Cofactors	Trimble RB, et al. (1980) Effect of glucosylation of lipid intermediates on oligosaccharide transfer in solubilized microsomes from Saccharomyces cerevisiae. J Biol Chem 255(24):11892-5	|OST1 |OST2 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1

Return to SGD

Send a Message to the SGD Curators