---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERP4/YOR016C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 361084 to 360461 CDS: 361084 - 360461 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERP4	YOR016C		ORF, Verified	S000005542
Description
Protein with similarity to Emp24p and Erv25p, member of the p24 family involved in ER to Golgi transport

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-09-30 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER to Golgi vesicle-mediated transport Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38        IGI : Inferred from Genetic Interaction with SGD:ERP2 Assigned on 2008-07-24 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000348 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0931 Assigned on 2008-02-14 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38        ISM : Inferred from Sequence Model Assigned on 2008-07-24 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000348 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERP4/YOR016C for ERP4 1) Springer S, et al. (2000) The p24 proteins are not essential for vesicular transport in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 97(8):4034-9        2) Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERP4/YOR016C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERP4/YOR016C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MRVFTLI C-term SRQKNYV Length(aa) 207 MW(Da) 23,515 pI 6.78 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.152   Codon Adaptation Index 0.179   Frequency of Optimal Codons 0.510   Hydropathicity of Protein 0.015   Aromaticity Score 0.111	10 20 30 40 50 | | | | | MRVFTLIAILFSSSLLTHAFSSNYAPVGISLPAFTKECLYYDLSSDKDVL VVSYQVLTGGNFEIDFDITAPDGSVIVTERQKKHSDFLLKSFGIGKYTFC LSNNYGTSPKKVEITLEKEKEIVSSHESKEDIIANNAIEEIDRNLNKITK TMDYLRAREWRNMYTVSSTESRLTWLSLLIMGVMVGISIVQALIIQFFFT SRQKNYV*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERP4/YOR016C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERP4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR016C	SGD Systematic Sequence
854181	NCBI: Gene ID
NP_014659.1	NCBI: RefSeq protein version ID
NP_014659.1	NCBI: RefSeq protein version ID
6324590	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
7 curated references; 0 references not yet curated
Non-Fungal Related Genes/Proteins	Boltz KA and Carney GE (2008) Loss of p24 function in Drosophila melanogaster causes a stress response and increased levels of NF-kappaB-regulated gene products. BMC Genomics 9:212	|EMP24 |ERP1 |ERP2 |ERP3 |ERP5 |ERP6 |ERV25
Protein Physical Properties	White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36	|ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes	Wagner A (2002) Asymmetric functional divergence of duplicate genes in yeast. Mol Biol Evol 19(10):1760-8	|ALD5 |CAT8 |CLB2 |CLB6 |DIG1 |DIG2 |ERP2 |HST3 |ISW1 |ISW2 |MBP1 |MSC7 |PAU2 |PPR1 |MORE
Reviews	Kaiser C (2000) Thinking about p24 proteins and how transport vesicles select their cargo. Proc Natl Acad Sci U S A 97(8):3783-5	|EMP24 |ERP1 |ERP2 |ERP3 |ERP5 |ERP6 |ERV25
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Springer S, et al. (2000) The p24 proteins are not essential for vesicular transport in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 97(8):4034-9	|EMP24 |ERP1 |ERP2 |ERP3 |ERP5 |ERP6 |ERV25 |GAS1
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Marzioch M, et al. (1999) Erp1p and Erp2p, partners for Emp24p and Erv25p in a yeast p24 complex. Mol Biol Cell 10(6):1923-38	|EMP24 |ERP1 |ERP2 |ERP3 |ERP5 |ERP6 |ERV25 |GAS1 |KAR2 |SEC13

Return to SGD

Send a Message to the SGD Curators