---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ALG6/YOR002W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 329418 to 331052 CDS: 329418 - 331052 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ALG6	YOR002W		ORF, Verified	S000005528
Description
Alpha 1,3 glucosyltransferase, involved in transfer of oligosaccharides from dolichyl pyrophosphate to asparagine residues of proteins during N-linked protein glycosylation; mutations in human ortholog are associated with disease

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity Burda P, et al. (1999) Ordered assembly of the asymmetrically branched lipid-linked oligosaccharide in the endoplasmic reticulum is ensured by the substrate specificity of the individual glycosyltransferases. Glycobiology 9(6):617-25        IMP : Inferred from Mutant Phenotype Assigned on 2007-08-10 SGD transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB transferase activity, transferring hexosyl groups Reiss G, et al. (1996) Isolation of the ALG6 locus of Saccharomyces cerevisiae required for glucosylation in the N-linked glycosylation pathway. Glycobiology 6(5):493-8      IMP : Inferred from Mutant Phenotype Assigned on 2002-08-30 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004856 Assigned on 2009-01-12 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By aerobic respiration Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44        IMP : Inferred from Mutant Phenotype Assigned on 2007-04-18 SGD cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT oligosaccharide-lipid intermediate assembly Burda P, et al. (1999) Ordered assembly of the asymmetrically branched lipid-linked oligosaccharide in the endoplasmic reticulum is ensured by the substrate specificity of the individual glycosyltransferases. Glycobiology 9(6):617-25        IMP : Inferred from Mutant Phenotype Assigned on 2007-04-27 SGD protein amino acid glycosylation Reiss G, et al. (1996) Isolation of the ALG6 locus of Saccharomyces cerevisiae required for glucosylation in the N-linked glycosylation pathway. Glycobiology 6(5):493-8      IMP : Inferred from Mutant Phenotype Assigned on 2002-08-30 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Reiss G, et al. (1996) Isolation of the ALG6 locus of Saccharomyces cerevisiae required for glucosylation in the N-linked glycosylation pathway. Glycobiology 6(5):493-8      IMP : Inferred from Mutant Phenotype Assigned on 2002-08-30 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004856 Assigned on 2009-06-17 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ALG6/YOR002W for ALG6 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). Alg6p, an alpha 1,3 glucosyltransferase, catalyzes the addition of the first glucose to the growing lipid-linked oligosaccharide (LLO) (3) in the lumen of the endoplasmic reticulum. Alg8p (4, 5) and Die2p (6) (also known as Alg10p) add the second and third glucoses, respectively. In a hexokinase/glucokinase-deficient background, alg6 mutants fail to accumulate intracellular glucose, indicating that glucose accumulates by trimming of glucose from LLO's (7). Human ALG6 (OMIM) rescues defective glycosylation in alg6 mutant yeast (8, 9, 10, 11, 12). Mutation of human ALG6 causes the congenital disorder of glycosylation CDG-Ic (OMIM) (8, 12), and may exacerbate CDG-Ia (OMIM) (11). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forALG6/YOR002W for ALG6 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Burda P, et al. (1999) Ordered assembly of the asymmetrically branched lipid-linked oligosaccharide in the endoplasmic reticulum is ensured by the substrate specificity of the individual glycosyltransferases. Glycobiology 9(6):617-25        4) Stagljar I, et al. (1994) New phenotype of mutations deficient in glucosylation of the lipid-linked oligosaccharide: cloning of the ALG8 locus. Proc Natl Acad Sci U S A 91(13):5977-81        5) Munoz MD, et al. (1994) Glycosylation of yeast exoglucanase sequons in alg mutants deficient in the glucosylation steps of the lipid-linked oligosaccharide. Presence of glucotriose unit in Dol-PP-GlcNAc2Man9Glc3 influences both glycosylation efficiency and selection of N-linked sites. Biochim Biophys Acta 1201(3):361-6      6) Burda P and Aebi M (1998) The ALG10 locus of Saccharomyces cerevisiae encodes the alpha-1,2 glucosyltransferase of the endoplasmic reticulum: the terminal glucose of the lipid-linked oligosaccharide is required for efficient N-linked glycosylation. Glycobiology 8(5):455-62        7) Miseta A, et al. (2003) A Saccharomyces cerevisiae mutant unable to convert glucose to glucose-6-phosphate accumulates excessive glucose in the endoplasmic reticulum due to core oligosaccharide trimming. Eukaryot Cell 2(3):534-41      8) Imbach T, et al. (1999) A mutation in the human ortholog of the Saccharomyces cerevisiae ALG6 gene causes carbohydrate-deficient glycoprotein syndrome type-Ic. Proc Natl Acad Sci U S A 96(12):6982-7        9) Imbach T, et al. (2000) Multi-allelic origin of congenital disorder of glycosylation (CDG)-Ic. Hum Genet 106(5):538-45        10) Westphal V, et al. (2000) Reduced heparan sulfate accumulation in enterocytes contributes to protein-losing enteropathy in a congenital disorder of glycosylation. Am J Pathol 157(6):1917-25        11) Westphal V, et al. (2002) A frequent mild mutation in ALG6 may exacerbate the clinical severity of patients with congenital disorder of glycosylation Ia (CDG-Ia) caused by phosphomannomutase deficiency. Hum Mol Genet 11(5):599-604        12) Westphal V, et al. (2000) Analysis of multiple mutations in the hALG6 gene in a patient with congenital disorder of glycosylation Ic. Mol Genet Metab 70(3):219-23        13) Reiss G, et al. (1996) Isolation of the ALG6 locus of Saccharomyces cerevisiae required for glucosylation in the N-linked glycosylation pathway. Glycobiology 6(5):493-8

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG6/YOR002W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG6/YOR002W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MAIGKRL C-term SKSMKDL Length(aa) 544 MW(Da) 62,782 pI 9.87 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.024   Codon Adaptation Index 0.112   Frequency of Optimal Codons 0.410   Hydropathicity of Protein 0.432   Aromaticity Score 0.184

10 20 30 40 50 | | | | | MAIGKRLLVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILR CTIGLGPYSGKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDY PPLTAFHSYLLGLIGSFFNPSWFALEKSRGFESPDNGLKTYMRSTVIISD ILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLIDHGHFQYN SVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSR SLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPF ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMT LLHPKKHLLPYVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNV LSLVSWINNVALFTLWPLLKKDGLHLQYAVSFLLSNWLIGNFSFITPRFL PKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFYHFLDQFV APPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG6/YOR002W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ALG6	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOR002W	SGD Systematic Sequence
854163	NCBI: Gene ID
NP_014644.1	NCBI: RefSeq protein version ID
NP_014644.1	NCBI: RefSeq protein version ID
6324575	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
34 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jonikas MC, et al. (2009) Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum. Science 323(5922):1693-7	|AIM27 |ALG12 |ALG3 |ALG5 |ALG8 |ALG9 |CUE1 |DER1 |DIE2 |EMC1 |EMC2 |EMC4 |EMC6 |GET1 |MORE
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |CBF1 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Mutants/Phenotypes	Loukin S, et al. (2008) A genome-wide survey suggests an osmoprotective role for vacuolar Ca2+ release in cell wall-compromised yeast. FASEB J 22(7):2405-15	|ALG5 |ALG8 |BST1 |CSF1 |DIE2 |GAS1 |GDA1 |GUP1 |HHY1 |HUR1 |KRE1 |KRE6 |LAS21 |MAK10 |MORE
Cell Cycle Phase Involved Mutants/Phenotypes Regulation of Strains/Constructs	Niu W, et al. (2008) Mechanisms of Cell Cycle Control Revealed by a Systematic and Quantitative Overexpression Screen in S. cerevisiae. PLoS Genet 4(7):e1000120	|ACT1 |AIM20 |AME1 |ARC1 |ARF1 |ASK1 |ATG26 |AVO2 |BET4 |BUL1 |CBF1 |CDC31 |CDC39 |CLB2 |MORE
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |ASK1 |MORE
Protein Processing/Modification/Regulation Protein Sequence Features	Gupta R, et al. (2007) Ubiquitination screen using protein microarrays for comprehensive identification of Rsp5 substrates in yeast. Mol Syst Biol 3:116	|ACK1 |ALY1 |ALY2 |ART10 |ART5 |BSC5 |BUL1 |CUE5 |DIA1 |EAR1 |ENT2 |LSB1 |NOP53 |NPL3 |MORE
Fungal Related Genes/Proteins	Hu W, et al. (2007) Essential gene identification and drug target prioritization in Aspergillus fumigatus. PLoS Pathog 3(3):e24	|AUR1 |BRX1 |CDS1 |ERG10 |ERG11 |ERG12 |ESF1 |FKS1 |GCD6 |GFA1 |GUS1 |HEM15 |HIS4 |IPP1 |MORE
Mutants/Phenotypes Strains/Constructs	Zakrzewska A, et al. (2007) Cellular Processes and Pathways That Protect Saccharomyces cerevisiae Cells against the Plasma Membrane-Perturbing Compound Chitosan. Eukaryot Cell 6(4):600-8	|ALG5 |ALG8 |ALG9 |DID4 |GET1 |GET2 |GET3 |GLO3 |HOG1 |MED1 |PAF1 |PBS2 |RTF1 |SEC22 |MORE
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Genetic Interactions	Takahashi H, et al. (2006) Nucleocytosolic acetyl-coenzyme a synthetase is required for histone acetylation and global transcription. Mol Cell 23(2):207-17	|ACS1 |ACS2 |BRE5 |CLA4 |GCN5 |GET2 |LTE1 |MDM20 |MON2 |PDA1 |POT1 |RUD3 |SAS2 |SPF1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44	|ALG3 |ALG5 |ALG7 |CHS1 |CNE1 |GPX2 |GSC2 |KAR2 |URA3 |YBR241C |YBR242W
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |BIG1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Uchimura S, et al. (2005) Effects of N-glycosylation and inositol on the ER stress response in yeast Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(7):1274-80	|ALG8 |DIE2 |HAC1 |INO1 |KAR2
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miseta A, et al. (2003) A Saccharomyces cerevisiae mutant unable to convert glucose to glucose-6-phosphate accumulates excessive glucose in the endoplasmic reticulum due to core oligosaccharide trimming. Eukaryot Cell 2(3):534-41	|ALG5 |GLK1 |HXK1 |HXK2
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Westphal V, et al. (2002) A frequent mild mutation in ALG6 may exacerbate the clinical severity of patients with congenital disorder of glycosylation Ia (CDG-Ia) caused by phosphomannomutase deficiency. Hum Mol Genet 11(5):599-604
Function/Process	Cipollo JF and Trimble RB (2000) The accumulation of Man(6)GlcNAc(2)-PP-dolichol in the Saccharomyces cerevisiae Deltaalg9 mutant reveals a regulatory role for the Alg3p alpha1,3-Man middle-arm addition in downstream oligosaccharide-lipid and glycoprotein glycan processing. J Biol Chem 275(6):4267-77	|ALG3 |ALG8 |ALG9 |CWH41 |DIE2 |OCH1 |ROT2 |SEC18
Disease Gene Related Non-Fungal Related Genes/Proteins	Imbach T, et al. (2000) Multi-allelic origin of congenital disorder of glycosylation (CDG)-Ic. Hum Genet 106(5):538-45
Disease Gene Related Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Westphal V, et al. (2000) Analysis of multiple mutations in the hALG6 gene in a patient with congenital disorder of glycosylation Ic. Mol Genet Metab 70(3):219-23
Disease Gene Related Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Westphal V, et al. (2000) Reduced heparan sulfate accumulation in enterocytes contributes to protein-losing enteropathy in a congenital disorder of glycosylation. Am J Pathol 157(6):1917-25
Function/Process Strains/Constructs Substrates/Ligands/Cofactors	Burda P, et al. (1999) Ordered assembly of the asymmetrically branched lipid-linked oligosaccharide in the endoplasmic reticulum is ensured by the substrate specificity of the individual glycosyltransferases. Glycobiology 9(6):617-25	|ALG12
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Castro O, et al. (1999) Uridine diphosphate-glucose transport into the endoplasmic reticulum of Saccharomyces cerevisiae: in vivo and in vitro evidence. Mol Biol Cell 10(4):1019-30	|ALG5 |KRE5
Disease Gene Related Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Imbach T, et al. (1999) A mutation in the human ortholog of the Saccharomyces cerevisiae ALG6 gene causes carbohydrate-deficient glycoprotein syndrome type-Ic. Proc Natl Acad Sci U S A 96(12):6982-7	|ALG5
Mutants/Phenotypes Other Features Strains/Constructs	Jakob CA, et al. (1998) Genetic tailoring of N-linked oligosaccharides: the role of glucose residues in glycoprotein processing of Saccharomyces cerevisiae in vivo. Glycobiology 8(2):155-64	|ALG8 |DIE2 |ROT2 |SEC18
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Reiss G, et al. (1996) Isolation of the ALG6 locus of Saccharomyces cerevisiae required for glucosylation in the N-linked glycosylation pathway. Glycobiology 6(5):493-8	|ALG8
Alias DNA/RNA Sequence Features	Sterky F, et al. (1996) The sequence of a 30 kb fragment on the left arm of chromosome XV from Saccharomyces cerevisiae reveals 15 open reading frames, five of which correspond to previously identified genes. Yeast 12(10B Suppl):1091-5	|IZH2 |PFA4 |PHO80 |RRP6 |SGT2 |SLG1 |TIR2 |TIR4 |TSR3 |UTP23 |YSP3
Genetic Interactions Mutants/Phenotypes	Zufferey R, et al. (1995) STT3, a highly conserved protein required for yeast oligosaccharyl transferase activity in vivo. EMBO J 14(20):4949-60	|ALG3 |ALG5 |ALG8 |ALG9 |DIE2 |STT3 |WBP1
Mutants/Phenotypes Techniques and Reagents	Munoz MD, et al. (1994) Glycosylation of yeast exoglucanase sequons in alg mutants deficient in the glucosylation steps of the lipid-linked oligosaccharide. Presence of glucotriose unit in Dol-PP-GlcNAc2Man9Glc3 influences both glycosylation efficiency and selection of N-linked sites. Biochim Biophys Acta 1201(3):361-6	|ALG5 |ALG8 |GLC3
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG1 |ALG2 |ALG3 |ALG5 |ALG7 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
Function/Process Mutants/Phenotypes Techniques and Reagents	Palamarczyk G, et al. (1990) Evidence that the synthesis of glucosylphosphodolichol in yeast involves a 35-kDa membrane protein. Proc Natl Acad Sci U S A 87(7):2666-70	|ALG5
Function/Process Mutants/Phenotypes Techniques and Reagents	Runge KW, et al. (1984) Two yeast mutations in glucosylation steps of the asparagine glycosylation pathway. J Biol Chem 259(1):412-7	|ALG5
Mutants/Phenotypes Techniques and Reagents	Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70	|ALG1 |ALG2 |ALG3 |ALG5 |SEC53

Return to SGD

Send a Message to the SGD Curators