ENB1/YOL158C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXV: 21310 to 19490
CDS: 21310 - 19490

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ENB1 YOL158C ARN4 ORF, Verified S000005518

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1999-12-21. Gene name expires on 2000-12-21.
Description
Endosomal ferric enterobactin transporter, expressed under conditions of iron deprivation; member of the major facilitator superfamily; expression is regulated by Rcs1p and affected by chloroquine treatment

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
ferric-enterobactin transmembrane transporter activity Heymann P, et al. (2000) A gene of the major facilitator superfamily encodes a transporter for enterobactin (Enb1p) in Saccharomyces cerevisiae. Biometals 13(1):65-72
     IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
iron ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0408
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ferric-enterobactin transport Heymann P, et al. (2000) A gene of the major facilitator superfamily encodes a transporter for enterobactin (Enb1p) in Saccharomyces cerevisiae. Biometals 13(1):65-72
     IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
ion transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0406
Assigned on 2007-05-23 UniProtKB
iron ion transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0410
Assigned on 2007-05-23 UniProtKB
transmembrane transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR011701
Assigned on 2009-10-01 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2009-01-12 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cytoplasmic membrane-bounded vesicle Philpott CC, et al. (2002) The response to iron deprivation in Saccharomyces cerevisiae: expression of siderophore-based systems of iron uptake. Biochem Soc Trans 30(4):698-702
       TAS : Traceable Author Statement
Assigned on 2002-09-12 SGD
endosome Philpott CC, et al. (2002) The response to iron deprivation in Saccharomyces cerevisiae: expression of siderophore-based systems of iron uptake. Biochem Soc Trans 30(4):698-702
       TAS : Traceable Author Statement
Assigned on 2002-09-12 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0967
Assigned on 2008-02-14 UniProtKB
integral to membrane Paulsen IT, et al. (1998) Unified inventory of established and putative transporters encoded within the complete genome of Saccharomyces cerevisiae. FEBS Lett 430(1-2):116-25
     ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2009-01-12 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forENB1/YOL158C for ENB1
1) Yun CW, et al. (2000) Desferrioxamine-mediated iron uptake in Saccharomyces cerevisiae. Evidence for two pathways of iron uptake. J Biol Chem 275(14):10709-15

2) Heymann P, et al. (2000) A gene of the major facilitator superfamily encodes a transporter for enterobactin (Enb1p) in Saccharomyces cerevisiae. Biometals 13(1):65-72

3) Yun CW, et al. (2000) Siderophore-iron uptake in saccharomyces cerevisiae. Identification of ferrichrome and fusarinine transporters. J Biol Chem 275(21):16354-9

4) Emerson LR, et al. (2002) Relationship between chloroquine toxicity and iron acquisition in Saccharomyces cerevisiae. Antimicrob Agents Chemother 46(3):787-96

5) Philpott CC, et al. (2002) The response to iron deprivation in Saccharomyces cerevisiae: expression of siderophore-based systems of iron uptake. Biochem Soc Trans 30(4):698-702

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ENB1/YOL158C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ENB1/YOL158C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MLETDHS

C-term LRRVIGY

Length(aa) 606

MW(Da) 66,969

pI 10.26

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.052

Codon Adaptation Index 0.103

Frequency of Optimal Codons 0.430

Hydropathicity of Protein 0.472

Aromaticity Score 0.116

10 20 30 40 50 | | | | | MLETDHSRNDNLDDKSTVCYSEKTDSNVEKSTTSGLRRIDAVNKVLSDYS SFTAFGVTFSSLKTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQ VGSINTVKSIVASVVAVPYARISDRFGRIECWIFALVLYTIGEIISAATP TFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAMNIFLIPVIIN TWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYAQYISW RSGKLPPLKLKEKGQTLRQTLWKFADDINLIGVILFTAFLVLVLLPLTIA GGATSKWREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPRVYLGDPTIY VALLMEFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTN IVVGIMLHFYPHPKVFVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIV VGIAGGMIRFPMWTLVHASTTHNEMATVTGLLMSVYQIGDAVGASIAGAI WTQRLAKELIQRLGSSLGMAIYKSPLNYLKKYPIGSEVRVQMIESYSKIQ RLLIIVSISFAAFNAVLCFFLRGFTVNKKQSLSAEEREKEKLKIKQQSWL RRVIGY*

Protein Structures from PDB: proteins of known structure with sequence similarity to ENB1/YOL158C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ENB1 2000-12-12 SGD (2007) Information without a citation in SGD

Alias Name(s) Reference
ARN4 Yun CW, et al. (2000) Desferrioxamine-mediated iron uptake in Saccharomyces cerevisiae. Evidence for two pathways of iron uptake. J Biol Chem 275(14):10709-15

Mapping Notes
Date Note
1998-11-10 Edition 15: The name ARN4 has also been used for this locus.
Cherry JM, et al. (1998) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 15)". Pp. 414-420 in 1998 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Standard Name	Date Standardized	Reference
ENB1	2000-12-12	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
ARN4	*Yun CW, et al.* (2000)** Desferrioxamine-mediated iron uptake in Saccharomyces cerevisiae. Evidence for two pathways of iron uptake. J Biol Chem 275(14):10709-15

Date	Note
1998-11-10	Edition 15: The name ARN4 has also been used for this locus. *Cherry JM, et al.* (1998)** "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 15)". Pp. 414-420 in 1998 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YOL158C SGD Systematic Sequence

854007 NCBI: Gene ID

NP_014484.1 NCBI: RefSeq protein version ID

NP_014484.1 NCBI: RefSeq protein version ID

6324415 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YOL158C	SGD Systematic Sequence
854007	NCBI: Gene ID
NP_014484.1	NCBI: RefSeq protein version ID
NP_014484.1	NCBI: RefSeq protein version ID
6324415	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
31 curated references; 0 references not yet curated
Alias
Mutants/Phenotypes
Protein Sequence Features
Deng Y, et al. (2009) Gga2 Mediates Sequential Ubiquitin-independent and Ubiquitin-dependent Steps in the Trafficking of ARN1 from the trans-Golgi Network to the Vacuole. J Biol Chem 284(35):23830-41
       |ARN1 |ENT3 |ENT4 |ENT5 |GGA2 |RSP5
Alias
RNA Levels and Processing
Mira NP, et al. (2009) The RIM101 pathway has a role in Saccharomyces cerevisiae adaptive response and resistance to propionic acid and other weak acids. FEMS Yeast Res 9(2):202-16
       |AFR1 |AQY2 |BAG7 |CIN5 |COS8 |CWP1 |DIT1 |DUR3 |FET4 |HPF1 |HSP26 |ICS2 |INO1 |JID1 |MORE
RNA Levels and Processing
Sideri TC, et al. (2009) Methionine sulphoxide reductases protect iron-sulphur clusters from oxidative inactivation in yeast. Microbiology 155(Pt 2):612-23
       |ACO1 |AFT1 |ARN2 |BIO2 |CCC2 |CTR1 |CTR2 |CUP1-1 |CUP1-2 |CUP5 |FET3 |FET4 |FIT2 |FIT3 |MORE
Evolution
Industrial Applications
Carreto L, et al. (2008) Comparative genomics of wild type yeast strains unveils important genome diversity. BMC Genomics 9524
       |AAD10 |AAD3 |AAD6 |ADH7 |AGP3 |ARR3 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |COG3 |CUP1-2 |DAK2 |DIP5 |MORE
RNA Levels and Processing
Lee YL and Lee CK (2008) Transcriptional Response According to Strength of Calorie Restriction in Saccharomyces cerevisiae. Mol Cells 26(3):299-307
       |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ARN1 |ATP1 |ATP12 |ATP3 |BNA4 |COR1 |COX20 |COX4 |COX6 |MORE
Reviews
Philpott CC and Protchenko O (2008) Response to Iron Deprivation in Saccharomyces cerevisiae. Eukaryot Cell 7(1):20-7
       |AFT1 |AFT2 |ATX1 |CCC2 |COT1 |FET3 |FET5 |FIT1 |FIT2 |FIT3 |FRE1 |FRE2 |FRE3 |FRE4 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Protein Processing/Modification/Regulation
Strains/Constructs
Froissard M, et al. (2007) Trafficking of Siderophore Transporters in Saccharomyces cerevisiae and Intracellular Fate of Ferrioxamine B Conjugates. Traffic 8(11):1601-16
         |ARN1 |GGA2 |SIT1 |TAF1 |VPS28
Regulation of
Transcription
Buck MJ and Lieb JD (2006) A chromatin-mediated mechanism for specification of conditional transcription factor targets. Nat Genet 38(12):1446-51
         |ACA1 |ACS1 |ADE3 |ADH1 |AGP1 |AIM38 |ANP1 |AQY1 |ASC1 |AST2 |ATG19 |AZF1 |BDF1 |BSC3 |MORE
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
RNA Levels and Processing
Regulation of
Transcription
Dubacq C, et al. (2006) Role of the iron mobilization and oxidative stress regulons in the genomic response of yeast to hydroxyurea. Mol Genet Genomics 275(2):114-24
         |AFT1 |AFT2 |CYC1 |HSP31 |PRX1 |ROX1 |SMF3 |SNF1 |TRR1 |YAP1
Transcription
Hazelwood LA, et al. (2006) A new physiological role for Pdr12p in Saccharomyces cerevisiae: export of aromatic and branched-chain organic acids produced in amino acid catabolism. FEMS Yeast Res 6(6):937-45
       |ACT1 |ADP1 |ARB1 |ARO10 |ATM1 |ATR1 |AUS1 |BPT1 |MDL1 |MDL2 |NFT1 |PDR10 |PDR11 |PDR12 |MORE
RNA Levels and Processing
Kim HJ, et al. (2006) Effect of textile wastewaters on Saccharomyces cerevisiae using DNA microarray as a tool for genome-wide transcriptomics analysis. Water Res 40(9):1773-82
       |AHP1 |ARN1 |ARN2 |ATX1 |FET3 |FIT1 |FIT2 |FIT3 |GPX2 |GRX1 |HMX1 |SIT1 |SRS2 |THI4 |MORE
Regulation of
Transcription
Ojeda L, et al. (2006) Role of glutaredoxin-3 and glutaredoxin-4 in the iron regulation of the Aft1 transcriptional activator in Saccharomyces cerevisiae. J Biol Chem 281(26):17661-9
       |AFT1 |ARN1 |CAD1 |COT1 |FET3 |FIT1 |FIT2 |FIT3 |GLR1 |GRX3 |GRX4 |GRX5 |ISU2 |MRS4 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Park YS, et al. (2006) Cellular iron utilization is regulated by putative siderophore transporter FgSit1 not by free iron transporter in Fusarium graminearum. Biochem Biophys Res Commun 345(4):1634-42
       |ARN1 |ARN2 |FET3 |SIT1
DNA/RNA Sequence Features
Regulation of
Transcription
Courel M, et al. (2005) Direct activation of genes involved in intracellular iron use by the yeast iron-responsive transcription factor Aft2 without its paralog Aft1. Mol Cell Biol 25(15):6760-71
         |AFT1 |AFT2 |AHP1 |AKR1 |ARA2 |ARN1 |ARN2 |ATX1 |BIO5 |BNA2 |CAD1 |CCC2 |COT1 |ECL1 |MORE
DNA/RNA Sequence Features
Mapping
Dunn B, et al. (2005) Microarray karyotyping of commercial wine yeast strains reveals shared, as well as unique, genomic signatures. BMC Genomics 6(1):53
           |ADH4 |ATR1 |AYT1 |BRR6 |CSE1 |CUP1-1 |CUP1-2 |HAP2 |HXK2 |HXT11 |HXT12 |HXT9 |KAP114 |MAL11 |MORE
Regulation of
Rutherford JC, et al. (2005) Activation of the iron regulon by the yeast Aft1/Aft2 transcription factors depends on mitochondrial but not cytosolic iron-sulfur protein biogenesis. J Biol Chem 280(11):10135-40
         |AFT1 |AFT2 |ARN1 |ARN2 |ATM1 |ATX1 |CFD1 |COT1 |FET3 |FIT2 |FIT3 |FRE1 |FRE3 |FTR1 |MORE
DNA/RNA Sequence Features
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
van Bakel H, et al. (2005) Gene expression profiling and phenotype analyses of S. cerevisiae in response to changing copper reveals six genes with new roles in copper and iron metabolism. Physiol Genomics 22(3):356-67
           |AFT1 |AFT2 |AGA1 |AGA2 |AKR1 |ALD3 |ALD5 |AMS1 |APE2 |AQY2 |ARG1 |ARN1 |ARN2 |ATP7 |MORE
Reviews
Rutherford JC and Bird AJ (2004) Metal-responsive transcription factors that regulate iron, zinc, and copper homeostasis in eukaryotic cells. Eukaryot Cell 3(1):1-13
         |ADE17 |ADH4 |AFT1 |AFT2 |AKR1 |ARN1 |ARN2 |ATX1 |BAG7 |BNA2 |CCC2 |COS1 |COS2 |COS3 |MORE
RNA Levels and Processing
Regulation of
Rutherford JC, et al. (2003) Aft1p and Aft2p mediate iron-responsive gene expression in yeast through related promoter elements. J Biol Chem 278(30):27636-43
           |AFT1 |AFT2 |AKR1 |ARA2 |ARN1 |ATX1 |BIO5 |BNA2 |CAD1 |COT1 |ECL1 |ECM4 |FET3 |FIT1 |MORE
Regulation of
Transcription
Emerson LR, et al. (2002) Relationship between chloroquine toxicity and iron acquisition in Saccharomyces cerevisiae. Antimicrob Agents Chemother 46(3):787-96
       |AFT1 |ARN2 |FET3 |FET4 |SIT1 |SMF2
Alias
Cellular Location
Function/Process
Regulation of
Substrates/Ligands/Cofactors
Philpott CC, et al. (2002) The response to iron deprivation in Saccharomyces cerevisiae: expression of siderophore-based systems of iron uptake. Biochem Soc Trans 30(4):698-702
       |AFT1 |ARN1 |ARN2 |FIT1 |FIT2 |FIT3 |SIT1
Function/Process
Regulation of
Lamb TM, et al. (2001) Alkaline response genes of Saccharomyces cerevisiae and their relationship to the RIM101 pathway. J Biol Chem 276(3):1850-6
       |CTR3 |ENA1 |FRE1 |NRG2 |PHO11 |PHO12 |PHO84 |RIM101 |RIM13 |SHC1 |TIS11 |VMA4 |YAR068W |YHR214W |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Lesuisse E, et al. (2001) Siderophore uptake and use by the yeast Saccharomyces cerevisiae. Microbiology 147(Pt 2):289-98
       |AFT1 |ARN1 |ARN2 |CYC8 |SIT1 |TUP1 |YFH1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Yun CW, et al. (2001) The role of the FRE family of plasma membrane reductases in the uptake of siderophore-iron in Saccharomyces cerevisiae. J Biol Chem 276(13):10218-23
       |AFT1 |ARN1 |ARN2 |FET3 |FRE1 |FRE2 |FRE3 |FRE4 |FRE5 |FRE6 |FRE7 |SIT1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Heymann P, et al. (2000) A gene of the major facilitator superfamily encodes a transporter for enterobactin (Enb1p) in Saccharomyces cerevisiae. Biometals 13(1):65-72

Function/Process
Heymann P, et al. (2000) Identification and substrate specificity of a ferrichrome-type siderophore transporter (Arn1p) in Saccharomyces cerevisiae. FEMS Microbiol Lett 186(2):221-7
       |ARN1 |ARN2 |SIT1
RNA Levels and Processing
Regulation of
Robertson LS, et al. (2000) The yeast A kinases differentially regulate iron uptake and respiratory function. Proc Natl Acad Sci U S A 97(11):5984-8
               |AQY2 |ARN1 |ARN2 |BAT1 |CCC2 |FET3 |FRE2 |FTR1 |ILV5 |MUC1 |NTH1 |SIT1 |TPK1 |TPK2 |MORE
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Regulation of
Transcription
Yun CW, et al. (2000) Desferrioxamine-mediated iron uptake in Saccharomyces cerevisiae. Evidence for two pathways of iron uptake. J Biol Chem 275(14):10709-15
         |AFT1 |ARN1 |ARN2 |FET3 |PEP12 |SIT1 |YCL073C |YKR106W
Function/Process
Fungal Related Genes/Proteins
Regulation of
Substrates/Ligands/Cofactors
Transcription
Yun CW, et al. (2000) Siderophore-iron uptake in saccharomyces cerevisiae. Identification of ferrichrome and fusarinine transporters. J Biol Chem 275(21):16354-9
       |AFT1 |ARN1 |ARN2 |FRE1 |FRE2 |FTR1 |SIT1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Nakamura T, et al. (1997) Yeast Crv4/Ttp1, a predicted type II membrane protein, is involved in an event important for growth, functionally overlapping with the event regulated by calcineurin- and Mpk1-mediated pathways. Mol Gen Genet 256(5):481-7
     |CNB1 |MNN2 |SLT2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.