THP1/YOL072W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXV: 194970 to 196337
CDS: 194970 - 196337

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

THP1 YOL072W BUD29 ORF, Verified S000005433

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-11. Gene name expires on 2001-09-11.
Description
Nuclear pore-associated protein, forms a complex with Sac3p that is involved in transcription and in mRNA export from the nucleus; contains a PAM domain implicated in protein-protein binding

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
RNA binding Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32
       IDA : Inferred from Direct Assay
Assigned on 2009-07-27 SGD
double-stranded DNA binding Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32
       IDA : Inferred from Direct Assay
Assigned on 2009-07-27 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
RNA elongation from RNA polymerase II promoter Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
mRNA 3'-end processing Saguez C, et al. (2008) Nuclear mRNA surveillance in THO/sub2 mutants is triggered by inefficient polyadenylation. Mol Cell 31(1):91-103
         IMP : Inferred from Mutant Phenotype
Assigned on 2008-08-21 SGD
mRNA export from nucleus Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52
         IMP : Inferred from Mutant Phenotype
Assigned on 2009-01-23 SGD
mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0509
Assigned on 2007-05-23 UniProtKB
transcription-coupled nucleotide-excision repair Gaillard H, et al. (2007) A new connection of mRNP biogenesis and export with transcription-coupled repair. Nucleic Acids Res 35(12):3893-906
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-07-06 SGD
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
nuclear envelope Teixeira MT, et al. (2002) Genome-wide nuclear morphology screen identifies novel genes involved in nuclear architecture and gene-silencing in Saccharomyces cerevisiae. J Mol Biol 321(4):551-61
             IDA : Inferred from Direct Assay
Assigned on 2009-07-27 SGD
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0178
Assigned on 2008-02-13 UniProtKB
nuclear pore Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52
         IGI : Inferred from Genetic Interaction
IDA : Inferred from Direct Assay
Assigned on 2003-06-05 SGD
nucleus Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89
       IDA : Inferred from Direct Assay
Assigned on 2009-07-27 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB
transcription export complex 2 Fischer T, et al. (2004) Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery. Nat Cell Biol 6(9):840-8
       IDA : Inferred from Direct Assay
Assigned on 2009-04-16 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forTHP1/YOL072W for THP1
1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

2) Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52

3) Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32

4) Ciccarelli FD, et al. (2003) The PAM domain, a multi-protein complex-associated module with an all-alpha-helix fold. BMC Bioinformatics 4():64

5) Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for THP1/YOL072W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for THP1/YOL072W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MDMANQL

C-term AHSHVLW

Length(aa) 455

MW(Da) 52,678

pI 9

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.072

Codon Adaptation Index 0.110

Frequency of Optimal Codons 0.447

Hydropathicity of Protein -0.129

Aromaticity Score 0.099

10 20 30 40 50 | | | | | MDMANQLLDELAHGNFSHLTLNLSQNGREIAILQKQLTGFDDKQLETFVE QHPAMPNDTRFKIMCTSFLNYARDVDPWSAWSSSDLIFEFYQCLINCLIN DNAPHIEMLIPVATRETEFIINLAGKLDSFHLQLHTRSHQFLSHISSILS RLFNSIKPPRGNASSTNIPGKQRILLYLVNKLNNIYFRIESPQLCSNIFK NFQPKSMLAHFNEYQLDQQIEYRYLLGRYYLLNSQVHNAFVQFNEAFQSL LNLPLTNQAITRNGTRILNYMIPTGLILGKMVKWGPLRPFLSQETIDNWS VLYKHVRYGNIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLIKTV IKSWTTEWGQNKLPYSLIERVLQLSIGPTFEDPGAQEITIYNGIHSPKNV ENVLVTLINLGLLRANCFPQLQLCVVKKTTMIQEIVPPVNERITKMFPAH SHVLW*

Protein Structures from PDB: proteins of known structure with sequence similarity to THP1/YOL072W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
THP1 2001-10-04 Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89

Alias Name(s) Reference
BUD29 Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Standard Name	Date Standardized	Reference
THP1	2001-10-04	Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89

Alias Name(s)	Reference
BUD29	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YOL072W SGD Systematic Sequence

854082 NCBI: Gene ID

NP_014569.1 NCBI: RefSeq protein version ID

NP_014569.1 NCBI: RefSeq protein version ID

6324500 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YOL072W	SGD Systematic Sequence
854082	NCBI: Gene ID
NP_014569.1	NCBI: RefSeq protein version ID
NP_014569.1	NCBI: RefSeq protein version ID
6324500	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
48 curated references; 0 references not yet curated
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8
       |GLE2 |INO1 |MLP2 |NUP1 |NUP157 |NUP2 |NUP60 |SAC3 |SUS1 |TSA2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Lee SK, et al. (2010) Activation of a Poised RNAPII-dependent Promoter Requires Both SAGA and Mediator. Genetics
     |ADA2 |AHC1 |ASC1 |BAS1 |CAF16 |CAF4 |CCR4 |CDC73 |CHD1 |CKA1 |CKA2 |CKB1 |CKB2 |CSE2 |MORE
Non-Fungal Related Genes/Proteins
Lu Q, et al. (2010) Arabidopsis homolog of the yeast TREX-2 mRNA export complex: components and anchoring nucleoporin. Plant J 61(2):259-70
       |CDC31 |NUP1 |SAC3 |SEM1 |SUS1
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Faza MB, et al. (2009) Sem1 is a functional component of the nuclear pore complex-associated messenger RNA export machinery. J Cell Biol 184(6):833-46
       |CSN12 |MEX67 |MTR2 |SAC3 |SEM1 |SUB2 |SUS1 |YPR045C |YRA1
Protein-protein Interactions
Strains/Constructs
Jani D, et al. (2009) Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export. Mol Cell 33(6):727-37
       |CDC31 |MEX67 |NUP133 |SAC3 |SUS1 |YRA1
Protein-protein Interactions
Klockner C, et al. (2009) Mutational Uncoupling of the Role of Sus1 in Nuclear Pore Complex Targeting of an mRNA Export Complex and Histone H2B Deubiquitination. J Biol Chem 284(18):12049-56
       |CDC31 |HTB1 |HTB2 |NGG1 |SAC3 |SGF11 |SGF73 |SPT7 |SUS1 |TRA1 |UBP8 |YRA1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Skruzny M, et al. (2009) An endoribonuclease functionally linked to perinuclear mRNP quality control associates with the nuclear pore complexes. PLoS Biol 7(1):e8
           |ESC1 |HPR1 |MFT1 |MLP1 |NPL3 |NUP133 |NUP60 |SAC3 |SSA1 |SUB2 |SUS1 |SWT1 |THO2 |THP2
Mutants/Phenotypes
Strains/Constructs
Westmoreland TJ, et al. (2009) Comparative genome-wide screening identifies a conserved doxorubicin repair network that is diploid specific in Saccharomyces cerevisiae. PLoS ONE 4(6):e5830
           |AFG3 |AKR1 |ARP5 |BEM1 |CCR4 |CTF4 |CTK1 |DBF2 |DHH1 |ERG3 |HFI1 |HOM6 |HPR1 |LGE1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8
       |DBP5 |GLE1 |HPR1 |MEX67 |MTR4 |NAB2 |NUP120 |NUP133 |NUP60 |NUP84 |PAP1 |RAT1 |RRP6 |SAC3 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Grund SE, et al. (2008) The inner nuclear membrane protein Src1 associates with subtelomeric genes and alters their regulated gene expression. J Cell Biol 182(5):897-910
       |CDC31 |HPR1 |MFT1 |PHO11 |PHO12 |PHO84 |SAC3 |SRC1 |SUB2 |SUS1 |THO2 |THP2
Cellular Location
Protein-protein Interactions
Kohler A, et al. (2008) Yeast Ataxin-7 links histone deubiquitination with gene gating and mRNA export. Nat Cell Biol 10(6):707-15
       |ADA2 |CDC31 |GAL1 |HTB1 |HTB2 |SAC3 |SGF11 |SGF73 |SUS1 |UBP8
Mutants/Phenotypes
Strains/Constructs
Pascual-Garcia P, et al. (2008) Sus1 is recruited to coding regions and functions during transcription elongation in association with SAGA and TREX2. Genes Dev 22(20):2811-22
       |ARG1 |GCN4 |GCN5 |MEX67 |RPB11 |RPB3 |RPB4 |RPB7 |RPB9 |RPO21 |SAC3 |SGF11 |SGF73 |SUS1 |MORE
Reviews
Rougemaille M, et al. (2008) mRNA journey to the cytoplasm: attire required. Biol Cell 100(6):327-42
       |CBC2 |CDC33 |HRB1 |MEX67 |MTR2 |NAB2 |NPL3 |PAB1 |SAC3 |STO1 |SUB2 |YRA1
Mutants/Phenotypes
Strains/Constructs
Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
       |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Saguez C, et al. (2008) Nuclear mRNA surveillance in THO/sub2 mutants is triggered by inefficient polyadenylation. Mol Cell 31(1):91-103
         |CDC73 |CTK1 |CTK2 |CTK3 |ELP3 |ELP4 |ELP6 |FCP1 |FIP1 |HPR1 |IKI1 |IKI3 |IOC3 |ISW1 |MORE
Computational analysis
Mutants/Phenotypes
Protein-protein Interactions
Schluter C, et al. (2008) Global Analysis of Yeast Endosomal Transport Identifies the Vps55/68 Sorting Complex. Mol Biol Cell 19(4):1282-1294
       |AKR1 |ARF1 |ARP5 |ARP6 |BRO1 |BUD32 |CDC50 |COG5 |COG6 |COG7 |COG8 |CUP5 |DID4 |EAF1 |MORE
Mutants/Phenotypes
Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16
       |ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP159 |NUP188 |NUP2 |MORE
Function/Process
Ulitsky I, et al. (2008) From E-MAPs to module maps: dissecting quantitative genetic interactions using physical interactions. Mol Syst Biol 4:209
       |BRE5 |CIK1 |GBP2 |KAR3 |RPN10 |SAC3 |SEM1 |UBP3 |UMP1 |VIK1 |YDL176W |YKL023W |YTA7
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Wilmes GM, et al. (2008) A genetic interaction map of RNA-processing factors reveals links between Sem1/Dss1-containing complexes and mRNA export and splicing. Mol Cell 32(5):735-46
       |APQ12 |BRR1 |CAK1 |CBC2 |CHD1 |CSN12 |CSN9 |DBP5 |GIM4 |IST3 |ISY1 |LRP1 |MEX67 |MUD2 |MORE
Reviews
Ahmed S and Brickner JH (2007) Regulation and epigenetic control of transcription at the nuclear periphery. Trends Genet 23(8):396-402
       |ADA2 |CHD1 |GCN5 |HFI1 |HTZ1 |MEX67 |MLP1 |MLP2 |NGG1 |NUP2 |NUP60 |NUP84 |SAC3 |SGF11 |MORE
Mutants/Phenotypes
Fairn GD, et al. (2007) A chemogenomic screen in Saccharomyces cerevisiae uncovers a primary role for the mitochondria in farnesol toxicity and its regulation by the Pkc1 pathway. J Biol Chem 282(7):4868-74
         |AIM21 |ARG4 |BCK1 |CBP1 |CLA4 |COR1 |COX11 |DAL5 |ECM33 |EOS1 |ERG6 |FSF1 |FUI1 |FUR4 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gaillard H, et al. (2007) A new connection of mRNP biogenesis and export with transcription-coupled repair. Nucleic Acids Res 35(12):3893-906
       |DEF1 |FMP27 |HPR1 |MEX67 |MFT1 |MTR2 |RAD26 |RAD7 |RPB10 |RPB11 |RPB2 |RPB3 |RPB4 |RPB5 |MORE
Reviews
Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73
       |ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Protein-protein Interactions
Techniques and Reagents
Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6
       |ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Function/Process
Rougemaille M, et al. (2007) Dissecting mechanisms of nuclear mRNA surveillance in THO/sub2 complex mutants. EMBO J 26(9):2317-26
     |AIR1 |AIR2 |HPR1 |HSP104 |LRP1 |MFT1 |MTR4 |PAP1 |PAP2 |PDR5 |RRP6 |SUB2 |THO2
Reviews
Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310
       |ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Cellular Location
Mutants/Phenotypes
Strains/Constructs
Caesar R, et al. (2006) Physiological importance and identification of novel targets for the N-terminal acetyltransferase NatB. Eukaryot Cell 5(2):368-78
       |ACT1 |ARP1 |BUD3 |CAC2 |CSM1 |DST1 |GIS1 |IOC3 |KAR3 |KAR9 |MDM20 |MLC2 |NAT3 |NNF2 |MORE
Mutants/Phenotypes
Techniques and Reagents
Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
       |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Jimeno S, et al. (2006) Tho1, a novel hnRNP, and Sub2 provide alternative pathways for mRNP biogenesis in yeast THO mutants. Mol Cell Biol 26(12):4387-98
       |HPR1 |MEX67 |MFT1 |NAB2 |SPT4 |SUB2 |THO1 |THO2 |THP2
Protein-protein Interactions
Kohler A, et al. (2006) The mRNA export factor Sus1 is involved in Spt/Ada/Gcn5 acetyltransferase-mediated H2B deubiquitinylation through its interaction with Ubp8 and Sgf11. Mol Biol Cell 17(10):4228-36
             |ADA2 |CDC31 |HHF1 |HHF2 |HHT1 |HHT2 |HTB1 |HTB2 |SAC3 |SGF11 |SPT20 |SPT7 |SUS1 |TAF12 |MORE
Protein-protein Interactions
Strains/Constructs
Proft M, et al. (2006) The stress-activated Hog1 kinase is a selective transcriptional elongation factor for genes responding to osmotic stress. Mol Cell 23(2):241-50
         |CTT1 |DST1 |GRE2 |HOG1 |PAF1 |RPO21 |SPT4 |STL1
Genetic Interactions
Mutants/Phenotypes
Ingvarsdottir K, et al. (2005) H2B ubiquitin protease Ubp8 and Sgf11 constitute a discrete functional module within the Saccharomyces cerevisiae SAGA complex. Mol Cell Biol 25(3):1162-72
           |ADA2 |ARP6 |BRE1 |BRE2 |CDC73 |CTR9 |ELP3 |ELP4 |ELP6 |GCN5 |HOS2 |HTZ1 |NGG1 |PAF1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Keogh MC, et al. (2005) Cotranscriptional set2 methylation of histone H3 lysine 36 recruits a repressive Rpd3 complex. Cell 123(4):593-605
       |ARP6 |ASF1 |CDC73 |CHD1 |CTI6 |DEP1 |DOA1 |EAF3 |ELP3 |ELP4 |ELP6 |HOS2 |HTZ1 |ISW1 |MORE
Reviews
Olesen JR, et al. (2005) A link between transcription and mRNP quality in Saccharomyces cerevisiae. RNA Biol 2(2):45-8
       |DST1 |HPR1 |HSP104 |MFT1 |PRP2 |RAD3 |RPB10 |RPB11 |RPB2 |RPB3 |RPB4 |RPB5 |RPB7 |RPB8 |MORE
Cellular Location
Protein-protein Interactions
Fischer T, et al. (2004) Yeast centrin Cdc31 is linked to the nuclear mRNA export machinery. Nat Cell Biol 6(9):840-8
       |CDC31 |SAC3 |SUS1
Large-scale phenotype analysis
Mutants/Phenotypes
Riles L, et al. (2004) Large-scale screening of yeast mutants for sensitivity to the IMP dehydrogenase inhibitor 6-azauracil. Yeast 21(3):241-8
         |ADE12 |BUL1 |CGI121 |COG1 |DLT1 |DST1 |DUN1 |EAF7 |FYV10 |GAL11 |GET1 |GIS4 |HUR1 |ILV6 |MORE
Function/Process
Protein-protein Interactions
Rodriguez-Navarro S, et al. (2004) Sus1, a functional component of the SAGA histone acetylase complex and the nuclear pore-associated mRNA export machinery. Cell 116(1):75-86
           |SAC3 |SUS1 |YRA1
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Ciccarelli FD, et al. (2003) The PAM domain, a multi-protein complex-associated module with an all-alpha-helix fold. BMC Bioinformatics 4():64
       |CSN12 |RPN3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Conde R, et al. (2003) Screening for new yeast mutants affected in mannosylphosphorylation of cell wall mannoproteins. Yeast 20(14):1189-211
         |ALG12 |ALG9 |BRE5 |COG5 |COG7 |COG8 |CYK3 |ELP2 |EXG1 |HOC1 |ITC1 |KTR6 |LCL2 |LDB7 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Gallardo M, et al. (2003) Nab2p and the Thp1p-Sac3p complex functionally interact at the interface between transcription and mRNA metabolism. J Biol Chem 278(26):24225-32
       |NAB2 |SAC3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Marin A, et al. (2003) Relationship between G+C content, ORF-length and mRNA concentration in Saccharomyces cerevisiae. Yeast 20(8):703-11
       |THO2
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Fischer T, et al. (2002) The mRNA export machinery requires the novel Sac3p-Thp1p complex to dock at the nucleoplasmic entrance of the nuclear pores. EMBO J 21(21):5843-52
         |MEX67 |MTR2 |NUP1 |SAC3 |SUB2 |YRA1
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Teixeira MT, et al. (2002) Genome-wide nuclear morphology screen identifies novel genes involved in nuclear architecture and gene-silencing in Saccharomyces cerevisiae. J Mol Biol 321(4):551-61
             |ARP5 |BRE1 |EMP46 |GRE2 |LSM1 |NOP1 |NUP49 |PTK2 |RPA34 |SEH1 |SSH1 |TDP1 |YHC3
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gallardo M and Aguilera A (2001) A new hyperrecombination mutation identifies a novel yeast gene, THP1, connecting transcription elongation with mitotic recombination. Genetics 157(1):79-89
       |HPR1 |PGD1 |THO2
Function/Process
Mutants/Phenotypes
Strains/Constructs
de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42
             |AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Mutants/Phenotypes
Strains/Constructs
Iwanejko L, et al. (1999) Disruption and functional analysis of six ORFs on chromosome XV: YOL117w, YOL115w ( TRF4), YOL114c, YOL112w ( MSB4), YOL111c and YOL072w. Yeast 15(14):1529-39
       |MDY2 |MSB3 |MSB4 |PAP2 |RRI2 |YOL114C
DNA/RNA Sequence Features
Tzermia M, et al. (1997) Sequence analysis of a 33.2 kb segment from the left arm of yeast chromosome XV reveals eight known genes and ten new open reading frames including homologues of ABC transporters, inositol phosphatases and human expressed sequence tags. Yeast 13(6):583-9
       |AVO1 |HST1 |IRA2 |MDM20 |MET22 |NUF2 |REX4 |RIB2 |RTG1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.