INP54/YOL065C Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
INP54 YOL065C   ORF, Verified S000005426
Description
Phosphatidylinositol 4,5-bisphosphate 5-phosphatase with a role in secretion, localizes to the endoplasmic reticulum via the C-terminal tail; lacks the Sac1 domain and proline-rich region found in the other 3 INP proteins

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
hydrolase activityGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2007-05-23
UniProtKB
inositol or phosphatidylinositol phosphatase activityDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR000300
Assigned on 2007-05-23
UniProtKB
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activityRaucher D, et al. (2000) Phosphatidylinositol 4,5-bisphosphate functions as a second messenger that regulates cytoskeleton-plasma membrane adhesion. Cell 100(2):221-8
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2008-06-09
SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with IUBMB:3.1.3.36
Assigned on 2007-05-23
UniProtKB
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
phosphoinositide dephosphorylationRaucher D, et al. (2000) Phosphatidylinositol 4,5-bisphosphate functions as a second messenger that regulates cytoskeleton-plasma membrane adhesion. Cell 100(2):221-8
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2008-06-09
SGD
protein transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23
UniProtKB
transportGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23
UniProtKB
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
endoplasmic reticulumWiradjaja F, et al. (2001) The yeast inositol polyphosphate 5-phosphatase Inp54p localizes to the endoplasmic reticulum via a C-terminal hydrophobic anchoring tail: regulation of secretion from the endoplasmic reticulum. J Biol Chem 276(10):7643-53
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2002-10-01
SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23
UniProtKB
membraneGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23
UniProtKB

Pathways [TOP] [NEXT] Help
phosphatidylinositol phosphate biosynthesis

Summary Paragraph [TOP] [NEXT] Help
SUMMARY PARAGRAPH for INP54/YOL065C for INP54
INP51, INP52, INP53, and INP54 encode members of a conserved family of phophoinositde phosphatases that contain an inositol polyphosphate 5-phosphatase domain (reviewed in 1 and 2). This domain in these enzymes specifically hydrolyzes phosphates at position 5 of inositol rings, PtdIns[4,5]P2 being the preferred substrate (3). Inp52p is partially redundant in function with both Inp51p and Inp53p, but these latter two proteins have cellular functions that are independent of each other (4). None of the genes is essential for growth, however a triple deletion of inp51 inp52 inp53 is lethal (4). The inviability of the triple-null strain can be rescued by expressing mouse Inpp5b (inositol polyphospate 5-phosphatase II, 5).

Inp51p, Inp52p, and Inp53p also possess a second catalytic domain known as the Sac1-like domain, which is highly conserved and also found in the IP phosphatases Sac1p, Fig4p, and mammalian synaptojanin-1 (SYNJ1) and synaptojanin-2 (SYNJ2) (reviewed in 1 and 2). The Sac1-like domain of Inp52p and Inp53p enables these proteins to recognize and dephosphorylate a broader range of substrates including PtdIns[3]P, PtdIns[4]P, and PtdIns[3,5]P2 (3). Although Inp51p contains a Sac1-like domain, this domain is non-functional due to mutations of key residues in the highly conserved CX5R(T/S) domain.

Inp54p tightly associates with the cytoplasmic side of the ER membrane via a hydrophobic region in its C-terminus (6). inp54 null mutants display increased levels of protein secretion (6).

About Phosphatidylinositol Phosphate Biosynthesis

The phosphorylated products of phosphatidylinositol (PtdIns, PI), collectively referred to as phosphoinositides or phosphatidylinositol phosphates (PtdInsPs, PIPs), are membrane-bound lipids that function as structural components of membranes, as well as regulators of many cellular processes in eukaryotes, including vesicle-mediated membrane trafficking, cell wall integrity, and actin cytoskeleton organization (reviewed in 1 and 7). PtdInsPs are also precursors of the water-soluble inositol phosphates (IPs), an important class of intracellular signaling molecules (reviewed in 8, 9 and 10).

The inositol ring of the membrane phospholipids and the water-soluble IPs are readily phosphorylated and dephosphorylated at a number of positions making them well suited as key regulators. PtdIns can be phosphorylated at one or a combination of positions (3', 4', or 5') on the inositol headgroup, generating a set of unique stereoisomers that have specific biological functions (reviewed in 1). These stereoisomers have been shown to be restricted to certain membranes (reviewed in 1). Phosphatidylinositol 4-phosphate (PtdIns4P) is the major PtdInsP species of the Golgi apparatus, where it plays a role in the vesicular trafficking of secretory proteins from the Golgi to the plasma membrane (reviewed in 1). Phosphatidylinositol 4,5-bisphosphate (PtdIns[4,5]P2) is the major species found at the plasma membrane and is involved in the regulation of actin cytoskeleton organization, as well as cell wall integrity, and heat shock response pathways (reviewed in 1). Phosphatidylinositol 3-phosphate (PtdIns3P) is found predominantly at endosomal membranes and in multivesicular bodies (MVB), where it plays a role in endosomal and vacuolar membrane trafficking. Phosphatidylinositol 3,5-bisphosphate (PtdIns[3,5]P2) is found on vacuolar membranes where it plays an important role in the MVB sorting pathway (reviewed in 1).

Phosphorylation and dephosphorylation of the inositol headgroups of PtdInsPs at specific membrane locations signals the recruitment of certain proteins essential for vesicular transport (7, and reviewed in 1). PtdInsPs recruit proteins that contain PtdInsP-specific binding domains, such as the well-studied pleckstrin homology (PH) domain that recognizes the phosphorylation pattern of specific PtdInsP inositol headgroups (reviewed in 1).

A number of kinases and phosphatases are involved in the generation and interconversions of PtdInsPs, the majority of which have been well conserved during evolution (reviewed in 1). The PtdInsP kinases, in contrast to the lipid phosphatases, have a higher degree of specificity. While each kinase appears to phosphorylate only one substrate, many of the lipid phosphatases can dephosphorylate a number of substrates.

Last Updated: 2008-06-09

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forINP54/YOL065C for INP54
1)Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
2)Hughes WE, et al. (2000) Sac phosphatase domain proteins. Biochem J 350 Pt 2():337-52
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
3)Guo S, et al. (1999) SAC1-like domains of yeast SAC1, INP52, and INP53 and of human synaptojanin encode polyphosphoinositide phosphatases. J Biol Chem 274(19):12990-5
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
4)Stolz LE, et al. (1998) Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae. Genetics 148(4):1715-29
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
5)O'Malley CJ, et al. (2001) Mammalian inositol polyphosphate 5-phosphatase II can compensate for the absence of all three yeast Sac1-like-domain-containing 5-phosphatases. Biochem J 355(Pt 3):805-17
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
6)Wiradjaja F, et al. (2001) The yeast inositol polyphosphate 5-phosphatase Inp54p localizes to the endoplasmic reticulum via a C-terminal hydrophobic anchoring tail: regulation of secretion from the endoplasmic reticulum. J Biol Chem 276(10):7643-53
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
7)De Camilli P, et al. (1996) Phosphoinositides as regulators in membrane traffic. Science 271(5255):1533-9
SGD Papers Entry  Pubmed Entry  
8)York JD (2006) Regulation of nuclear processes by inositol polyphosphates. Biochim Biophys Acta 1761(5-6):552-9
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
9)Bennett M, et al. (2006) Inositol pyrophosphates: metabolism and signaling. Cell Mol Life Sci 63(5):552-64
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
10)Bhandari R, et al. (2007) Inositol pyrophosphate pyrotechnics. Cell Metab 5(5):321-3
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
11)Stolz LE, et al. (1998) INP51, a yeast inositol polyphosphate 5-phosphatase required for phosphatidylinositol 4,5-bisphosphate homeostasis and whose absence confers a cold-resistant phenotype. J Biol Chem 273(19):11852-61
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for INP54/YOL065C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for INP54/YOL065C

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MNKTNWK
    C-term YLLLKIL
    Length(aa) 384
    MW(Da) 43,799
    pI 7.6
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias -0.021  
    Codon Adaptation Index 0.114  
    Frequency of Optimal Codons 0.394  
    Hydropathicity of Protein -0.271  
    Aromaticity Score 0.112  

                              10        20        30        40        50
                               |         |         |         |         |
                      MNKTNWKVSVTTFNCGKEFPVENSKAIVKQLLFPYDDGISQLELQDLYVL
                      GFQEVVPIWQGSFPAVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGV
                      NSLGAITIIVLYNNNALKVKDDILKRNGKCGWFGTHLKGGTLISFQMTRN
                      GEENWERFSYICAHLNANEGVNNRNQRIDDYKRIMSEVCDSEVAKSDHFF
                      FLGDLNFRVTSTYDPTTNYSSTTTLRRLLENHEELNLLRKGEDEPLCKGF
                      QELKITFPPTYKFKLFEKETYNTKRIPSWCDRILYKSYAVPTFAQEGTYH
                      SVPRSNALLFSDHQPVNLTVRLPRSTGTPVPLSLHIEKYPLSWSSGLIGQ
                      IGDAVIGYCGWLVTKNVHYWILGSLLLYLLLKIL*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to INP54/YOL065C, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to INP54Homolog Source (per PDB)Protein Alignment: INP54 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    1i9y ( Chain: A)
    Crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin
  • PDB_Info
  • PDB_Structure
  • Schizosaccharomyces pombe1.6e-182926View alignmentSCOP
    MMDB
    CATH
    1i9z ( Chain: A)
    Crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin in complex with inositol (1,4)-bisphosphate and calcium ion
  • PDB_Info
  • PDB_Structure
  • Schizosaccharomyces pombe1.6e-182926View alignmentSCOP
    MMDB
    CATH
    1ntf ( Chain: A)
    Crystal structure of cimex nitrophorin
  • PDB_Info
  • PDB_Structure
  • Cimex lectularius1.8e-102726View alignmentSCOP
    MMDB
    CATH
    2imq ( Chain: X)
    Crystal structure of ferrous cimex nitrophorin
  • PDB_Info
  • PDB_Structure
  • Cimex lectularius1.8e-102726View alignmentSCOP
    MMDB
    CATH
    1y21 ( Chain: A)
    Crystal structure of cimex nitrophorin no complex
  • PDB_Info
  • PDB_Structure
  • Cimex lectularius1.8e-102726View alignmentSCOP
    MMDB
    CATH
    1yjh ( Chain: A)
    Crystal structure of cimex nitrophorin ferrous no complex
  • PDB_Info
  • PDB_Structure
  • Cimex lectularius1.8e-102726View alignmentSCOP
    MMDB
    CATH
    1si6 ( Chain: X)
    Crystal structure of cimex nitrophorin complex with co
  • PDB_Info
  • PDB_Structure
  • Cimex lectularius1.8e-102726View alignmentSCOP
    MMDB
    CATH

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameReference
    INP54Stolz LE, et al. (1998) Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae. Genetics 148(4):1715-29
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YOL065CSGD Systematic Sequence
    854089NCBI: Gene ID
    NP_014576.1NCBI: RefSeq protein version ID
    NP_014576.1NCBI: RefSeq protein version ID
    6324507NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    10 curated references; 0 references not yet curated
    Reviews
    Liu J, et al. (2009) Mechanochemical crosstalk during endocytic vesicle formation. Curr Opin Cell Biol
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACT1 |ARF1 |INP51 |INP52 |INP53 |MYO1 |RVS161 |RVS167 |SAC1 |YMR1
    Reviews
    Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |FAB1 |FIG4 |INP51 |INP52 |INP53 |LSB6 |MSS4 |PIK1 |PLC1 |SAC1 |STT4 |VPS34 |YMR1
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Wiradjaja F, et al. (2007) Inactivation of the phosphoinositide phosphatases Sac1p and Inp54p leads to accumulation of phosphatidylinositol 4,5-bisphosphate on vacuole membranes and vacuolar fusion defects. J Biol Chem 282(22):16295-307
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |SAC1
    Protein-protein Interactions
    Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
    Non-Fungal Related Genes/Proteins
    Mitchell CA, et al. (2002) Inositol polyphosphate 5-phosphatases: lipid phosphatases with flair. IUBMB Life 53(1):25-36
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |INP52 |INP53
    Fungal Related Genes/Proteins
    Protein Sequence Features
    O'Malley CJ, et al. (2001) Mammalian inositol polyphosphate 5-phosphatase II can compensate for the absence of all three yeast Sac1-like-domain-containing 5-phosphatases. Biochem J 355(Pt 3):805-17
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |INP51 |INP52 |INP53 |SAC1
    Cellular Location
    Function/Process
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Wiradjaja F, et al. (2001) The yeast inositol polyphosphate 5-phosphatase Inp54p localizes to the endoplasmic reticulum via a C-terminal hydrophobic anchoring tail: regulation of secretion from the endoplasmic reticulum. J Biol Chem 276(10):7643-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |INP51 |INP52 |INP53
    Reviews
    Odorizzi G, et al. (2000) Phosphoinositide signaling and the regulation of membrane trafficking in yeast. Trends Biochem Sci 25(5):229-35
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |FAB1 |FIG4 |FRQ1 |INP51 |INP52 |INP53 |MSS4 |PEP1 |PEP12 |PEP7 |PIB1 |PIB2 |PIK1 |SAC1 |MORE
    Function/Process
    Substrates/Ligands/Cofactors
    Raucher D, et al. (2000) Phosphatidylinositol 4,5-bisphosphate functions as a second messenger that regulates cytoskeleton-plasma membrane adhesion. Cell 100(2):221-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    DNA/RNA Sequence Features
    Fungal Related Genes/Proteins
    Stolz LE, et al. (1998) Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae. Genetics 148(4):1715-29
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |INP51 |INP52 |INP53 |SAC1


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.