---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SIL1/YOL031C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXV: 267530 to 266265 CDS: 267530 - 266265 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SIL1	YOL031C	SLS1	ORF, Verified	S000005391
See Nomenclature Note.
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2003-07-23. Gene name expires on 2004-07-23.
Description
Nucleotide exchange factor for the endoplasmic reticulum (ER) lumenal Hsp70 chaperone Kar2p, required for protein translocation into the ER; homolog of Yarrowia lipolytica SLS1; GrpE-like protein

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By adenyl-nucleotide exchange factor activity Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34        IPI : Inferred from Physical Interaction with SGD:KAR2 IDA : Inferred from Direct Assay Assigned on 2006-09-05 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By SRP-dependent cotranslational protein targeting to membrane, translocation Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2001-06-26 SGD cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439        RCA : Reviewed Computational Analysis Assigned on 2009-03-03 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB response to unfolded protein Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34        IPI : Inferred from Physical Interaction Assigned on 2001-06-26 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2009-10-01 UniProtKB endoplasmic reticulum lumen GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0096 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forSIL1/YOL031C for SIL1 1) Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34        2) Tyson JR and Stirling CJ (2000) LHS1 and SIL1 provide a lumenal function that is essential for protein translocation into the endoplasmic reticulum. EMBO J 19(23):6440-52          3) Kabani M, et al. (2002) HspBP1, a homologue of the yeast Fes1 and Sls1 proteins, is an Hsc70 nucleotide exchange factor. FEBS Lett 531(2):339-42

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SIL1/YOL031C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SIL1/YOL031C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVRILPI C-term KNFRDEL Length(aa) 421 MW(Da) 48,274 pI 5.32 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.076   Codon Adaptation Index 0.153   Frequency of Optimal Codons 0.458   Hydropathicity of Protein -0.455   Aromaticity Score 0.074

10 20 30 40 50 | | | | | MVRILPIILSALSSKLVASTILHSSIHSVPSGGEIISAEDLKELEISGNS ICVDNRCYPKIFEPRHDWQPILPGQELPGGLDIRINMDTGLKEAKLNDEK NVGDNGSHELIVSSEDMKASPGDYEFSSDFKEMRNIIDSNPTLSSQDIAR LEDSFDRIMEFAHDYKHGYKIITHEFALLANLSLNENLPLTLRELSTRVI TSCLRNNPPVVEFINESFPNFKSKIMAALSNLNDSNHRSSNILIKRYLSI LNELPVTSEDLPIYSTVVLQNVYERNNKDKQLQIKVLELISKILKADMYE NDDTNLILFKRNAENWSSNLQEWANEFQEMVQNKSIDELHTRTFFDTLYN LKKIFKSDITINKGFLNWLAQQCKARQSNLDNGLQERDTEQDSFDKKLID SRHLIFGNPMAHRIKNFRDEL*

Protein Structures from PDB: proteins of known structure with sequence similarity to SIL1/YOL031C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
SIL1	2003-07-23	Tyson JR and Stirling CJ (2000) LHS1 and SIL1 provide a lumenal function that is essential for protein translocation into the endoplasmic reticulum. EMBO J 19(23):6440-52

Alias Name(s)	Reference
SLS1	Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34

Nomenclature History Notes

Date	Note
2001-02-21	The alias SLS1 should not be confused with SLS1/YLR139C, a mitochondrial integral membrane protein
2003-12-09	Both YOL031C and YLR139C have been referred to as SLS1.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YOL031C	SGD Systematic Sequence
854126	NCBI: Gene ID
NP_014611.1	NCBI: RefSeq protein version ID
NP_014611.1	NCBI: RefSeq protein version ID
6324542	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
13 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs	Payne T, et al. (2008) Modulation of Chaperone Gene Expression in Mutagenized Saccharomyces cerevisiae Strains Developed for Recombinant Human Albumin Production Results in Increased Production of Multiple Heterologous Proteins. Appl Environ Microbiol 74(24):7759-66	|HAC1 |JEM1 |LHS1 |SCJ1
Regulation of	Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439	|ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
DNA/RNA Sequence Features Techniques and Reagents	Doyon JB and Liu DR (2007) Identification of eukaryotic promoter regulatory elements using nonhomologous random recombination. Nucleic Acids Res 35(17):5851-60	|CRZ1 |HAC1 |KAR1
Mutants/Phenotypes Strains/Constructs	Martineau CN, et al. (2007) Flo11p-independent control of "mat" formation by hsp70 molecular chaperones and nucleotide exchange factors in yeast. Genetics 177(3):1679-89	|FES1 |MUC1 |SSA1 |SSA2 |SSA3 |SSA4 |SSE1 |SSE2 |YDJ1
Mutants/Phenotypes	Chen Y, et al. (2005) Identification of mitogen-activated protein kinase signaling pathways that confer resistance to endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Cancer Res 3(12):669-77	|ALG3 |ALG8 |ALG9 |ARD1 |BCK1 |CMR2 |CNB1 |DAL81 |DID2 |EDE1 |ERV25 |FPS1 |FYV8 |HAC1 |MORE
Function/Process Protein-protein Interactions Regulatory Role Strains/Constructs Techniques and Reagents	Steel GJ, et al. (2004) Coordinated activation of Hsp70 chaperones. Science 303(5654):98-101	|IRE1 |KAR2 |LHS1 |SEC63
Alias	Kabani M, et al. (2002) HspBP1, a homologue of the yeast Fes1 and Sls1 proteins, is an Hsc70 nucleotide exchange factor. FEBS Lett 531(2):339-42	|FES1 |SSA1
Function/Process Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Strains/Constructs	Kabani M, et al. (2002) Nucleotide exchange factor for the yeast Hsp70 molecular chaperone Ssa1p. Mol Cell Biol 22(13):4677-89	|FES1 |KAR2 |SSA1 |YDJ1
Non-Fungal Related Genes/Proteins	Kabani M, et al. (2000) A highly representative two-hybrid genomic library for the yeast Yarrowia lipolytica. Gene 241(2):309-15	|KAR2
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Strains/Constructs	Kabani M, et al. (2000) Sls1p stimulates Sec63p-mediated activation of Kar2p in a conformation-dependent manner in the yeast endoplasmic reticulum. Mol Cell Biol 20(18):6923-34	|KAR2 |MGE1 |SEC63
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Regulation of	Tyson JR and Stirling CJ (2000) LHS1 and SIL1 provide a lumenal function that is essential for protein translocation into the endoplasmic reticulum. EMBO J 19(23):6440-52	|IRE1 |KAR2 |LHS1
Non-Fungal Related Genes/Proteins	Boisrame A, et al. (1998) Interaction of Kar2p and Sls1p is required for efficient co-translational translocation of secreted proteins in the yeast Yarrowia lipolytica. J Biol Chem 273(47):30903-8	|KAR2 |SEC61
DNA/RNA Sequence Features Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Rad MR, et al. (1997) Analysis of the DNA sequence of a 34,038 bp region on the left arm of yeast chromosome XV. Yeast 13(3):281-6	|DIS3 |GAS1 |GAS5 |IFM1 |LAG2 |MDM38 |MIM1 |MSE1 |OPI10 |PRE6 |RPP2A |SMC5 |TAT2 |TSR4 |MORE

Return to SGD

Send a Message to the SGD Curators