---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ARE2/YNR019W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 665342 to 667270 CDS: 665342 - 667270 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ARE2	YNR019W	SAT1	ORF, Verified	S000005302
Description
Acyl-CoA:sterol acyltransferase, isozyme of Are1p; endoplasmic reticulum enzyme that contributes the major sterol esterification activity in the presence of oxygen

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By acyltransferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0012 Assigned on 2007-05-23 UniProtKB cholesterol O-acyltransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.26 Assigned on 2008-10-02 UniProtKB ergosterol O-acyltransferase activity Zweytick D, et al. (2000) Contribution of Are1p and Are2p to steryl ester synthesis in the yeast Saccharomyces cerevisiae. Eur J Biochem 267(4):1075-82        IGI : Inferred from Genetic Interaction with SGD:ARE1 IMP : Inferred from Mutant Phenotype Assigned on 2008-08-29 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.26 Assigned on 2008-10-02 UniProtKB lanosterol O-acyltransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.26 Assigned on 2008-10-02 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ergosterol metabolic process Zweytick D, et al. (2000) Contribution of Are1p and Are2p to steryl ester synthesis in the yeast Saccharomyces cerevisiae. Eur J Biochem 267(4):1075-82        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:ARE1 Assigned on 2008-08-29 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Zweytick D, et al. (2000) Contribution of Are1p and Are2p to steryl ester synthesis in the yeast Saccharomyces cerevisiae. Eur J Biochem 267(4):1075-82        IDA : Inferred from Direct Assay Assigned on 2002-09-06 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forARE2/YNR019W for ARE2 1) Yu C, et al. (1996) Molecular cloning and characterization of two isoforms of Saccharomyces cerevisiae acyl-CoA:sterol acyltransferase. J Biol Chem 271(39):24157-63        2) Zweytick D, et al. (2000) Contribution of Are1p and Are2p to steryl ester synthesis in the yeast Saccharomyces cerevisiae. Eur J Biochem 267(4):1075-82        3) Valachovic M, et al. (2001) Anaerobiosis induces complex changes in sterol esterification pattern in the yeast Saccharomyces cerevisiae. FEMS Microbiol Lett 197(1):41-5        4) Yang H, et al. (1996) Sterol esterification in yeast: a two-gene process. Science 272(5266):1353-6

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ARE2/YNR019W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ARE2/YNR019W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MDKKKDL C-term CTLYLTF Length(aa) 642 MW(Da) 74,022 pI 7.71 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.183   Codon Adaptation Index 0.192   Frequency of Optimal Codons 0.522   Hydropathicity of Protein 0.092   Aromaticity Score 0.146

10 20 30 40 50 | | | | | MDKKKDLLENEQFLRIQKLNAADAGKRQSITVDDEGELYGLDTSGNSPAN EHTATTITQNHSVVASNGDVAFIPGTATEGNTEIVTEEVIETDDNMFKTH VKTLSSKEKARYRQGSSNFISYFDDMSFEHRPSILDGSVNEPFKTKFVGP TLEKEIRRREKELMAMRKNLHHRKSSPDAVDSVGKNDGAAPTTVPTAATS ETVVTVETTIISSNFSGLYVAFWMAIAFGAVKALIDYYYQHNGSFKDSEI LKFMTTNLFTVASVDLLMYLSTYFVVGIQYLCKWGVLKWGTTGWIFTSIY EFLFVIFYMYLTENILKLHWLSKIFLFLHSLVLLMKMHSFAFYNGYLWGI KEELQFSKSALAKYKDSINDPKVIGALEKSCEFCSFELSSQSLSDQTQKF PNNISAKSFFWFTMFPTLIYQIEYPRTKEIRWSYVLEKICAIFGTIFLMM IDAQILMYPVAMRALAVRNSEWTGILDRLLKWVGLLVDIVPGFIVMYILD FYLIWDAILNCVAELTRFGDRYFYGDWWNCVSWADFSRIWNIPVHKFLLR HVYHSSMSSFKLNKSQATLMTFFLSSVVHELAMYVIFKKLRFYLFFFQML QMPLVALTNTKFMRNRTIIGNVIFWLGICMGPSVMCTLYLTF*

Protein Structures from PDB: proteins of known structure with sequence similarity to ARE2/YNR019W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ARE2	Yang H, et al. (1996) Sterol esterification in yeast: a two-gene process. Science 272(5266):1353-6

Alias Name(s)	Reference
SAT1	Yu C, et al. (1996) Molecular cloning and characterization of two isoforms of Saccharomyces cerevisiae acyl-CoA:sterol acyltransferase. J Biol Chem 271(39):24157-63

Nomenclature History Notes

Date	Note
2001-03-07	In addition to the use of a SAT name for the gene SAT4, SAT aliases have been used for both the AGE and the ARE genes, SAT1 for AGE1 and ARE2, SAT2 for AGE2 and ARE1.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNR019W	SGD Systematic Sequence
855753	NCBI: Gene ID
NP_014416.1	NCBI: RefSeq protein version ID
NP_014416.1	NCBI: RefSeq protein version ID
6324346	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
57 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes	Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151	|ACC1 |APQ12 |ARE1 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |FEN1 |LRO1 |MORE
Reviews	Kohlwein SD (2010) Obese and anorexic yeasts: Experimental models to understand the metabolic syndrome and lipotoxicity. Biochim Biophys Acta	|ACC1 |ALE1 |ARE1 |DGA1 |FAA1 |FAA2 |FAA3 |FAA4 |FAT1 |GPT2 |LRO1 |MGA2 |MIG1 |OLE1 |MORE
Genetic Interactions Strains/Constructs Transcription	Fei W, et al. (2009) Conditions of endoplasmic reticulum stress stimulate lipid droplet formation in Saccharomyces cerevisiae. Biochem J 424(1):61-7	|ANP1 |ARE1 |DGA1 |ERD1 |HRD1 |IRE1 |LRO1 |MNN10 |MNN11 |OCH1 |OST4 |PMR1 |SSM4
Reviews	Garbarino J and Sturley SL (2009) Saturated with fat: new perspectives on lipotoxicity. Curr Opin Clin Nutr Metab Care 12(2):110-6	|ARE1 |DGA1 |LRO1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Garbarino J, et al. (2009) Sterol and diacylglycerol acyltransferase deficiency triggers fatty acid-mediated cell death. J Biol Chem 284(45):30994-1005	|ARE1 |BFR1 |CHO2 |DGA1 |DGK1 |GET1 |GET2 |GET3 |ICE2 |LRO1 |OPI3 |RDL1 |SFB2 |TSC3
Cell Cycle Phase Involved Regulation of	Goldberg AA, et al. (2009) Effect of calorie restriction on the metabolic history of chronologically aging yeast. Exp Gerontol 44(9):555-71	|ABF2 |ACO1 |ACT1 |ADH1 |ADH2 |ALD4 |ATH1 |ATP1 |ATP2 |AYR1 |CAF4 |CCP1 |CIT1 |CIT2 |MORE
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Lin M, et al. (2009) Modulation of sterol homeostasis by the Cdc42p effectors Cla4p and Ste20p in the yeast Saccharomyces cerevisiae. FEBS J 276(24):7253-64	|ARE1 |BEM1 |CBR1 |CLA4 |CLN1 |ERG4 |NCP1 |STE20 |SWE1
Strains/Constructs	Mavraganis I, et al. (2009) A type II diacylglycerol acyltransferase from Claviceps purpurea with substrate preference towards ricinoleic acid, a hydroxyl fatty acid of industrial importance. Appl Environ Microbiol	|ARE1 |DGA1 |LRO1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Petschnigg J, et al. (2009) Good fat, essential cellular requirements for triacylglycerol synthesis to maintain membrane homeostasis in yeast. J Biol Chem 284(45):30981-93	|ARE1 |DGA1 |IRE1 |LRO1
Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Siloto RM, et al. (2009) Simple methods to detect triacylglycerol biosynthesis in a yeast-based recombinant system. Lipids 44(10):963-73	|ARE1 |DGA1 |LRO1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Spanova M, et al. (2009) Effect of lipid particle biogenesis on the subcellular distribution of squalene in the yeast Saccharomyces cerevisiae. J Biol Chem	|ARE1 |DGA1 |HEM1 |LRO1
RNA Levels and Processing	Verbelen PJ, et al. (2009) The influence of yeast oxygenation prior to brewery fermentation on yeast metabolism and the oxidative stress response. FEMS Yeast Res 9(2):226-39	|ACT1 |COX15 |CTA1 |CTT1 |CYC1 |CYC7 |ERG1 |ERG11 |HAP1 |HSP12 |OLE1 |PAU5 |QCR9 |ROX1 |MORE
Transcription	Zara G, et al. (2009) Oxygen is required to restore flor strain viability and lipid biosynthesis under fermentative conditions. FEMS Yeast Res 9(2):217-25	|ACC1 |ACS1 |ACS2 |ARE1 |ERG1 |ERG11 |OLE1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Czabany T, et al. (2008) Structural and Biochemical Properties of Lipid Particles from the Yeast Saccharomyces cerevisiae. J Biol Chem 283(25):17065-17074	|ARE1 |DGA1 |ERG1 |LRO1 |POR1 |PRC1 |WBP1
Non-Fungal Related Genes/Proteins	Das A, et al. (2008) Identification of putative active site residues of ACAT enzymes. J Lipid Res 49(8):1770-81	|ARE1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaspar ML, et al. (2008) A Block in Endoplasmic Reticulum-to-Golgi Trafficking Inhibits Phospholipid Synthesis and Induces Neutral Lipid Accumulation. J Biol Chem 283(37):25735-51	|DGA1 |HAC1 |LRO1 |SEC13 |SEC31 |SEC6
Mutants/Phenotypes Strains/Constructs	Stalberg K, et al. (2008) Identification of a novel GPCAT activity and a new pathway for phosphatidylcholine biosynthesis in S. cerevisiae. J Lipid Res 49(8):1794-806	|ALE1 |ARE1 |CST26 |DGA1 |GDE1 |GIT1 |GPT2 |GUP1 |HNM1 |LRO1 |MUM3 |PCT1 |PEP7 |PMC1 |MORE
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Xu J, et al. (2008) Cloning and characterization of an acyl-CoA-dependent diacylglycerol acyltransferase 1 (DGAT1) gene from Tropaeolum majus, and a study of the functional motifs of the DGAT protein using site-directed mutagenesis to modify enzyme activity and oil content. Plant Biotechnol J 6(8):799-818	|ARE1 |DGA1 |LRO1
RNA Levels and Processing	Zara G, et al. (2008) Correlation between cell lipid content, gene expression and fermentative behaviour of two Saccharomyces cerevisiae wine strains. J Appl Microbiol 104(3):906-14	|ACC1 |ACS1 |ACS2 |ARE1 |ERG10 |ERG9 |OLE1
Mutants/Phenotypes	Bishop AL, et al. (2007) Phenotypic heterogeneity can enhance rare-cell survival in 'stress-sensitive' yeast populations. Mol Microbiol 63(2):507-20	|ADE12 |ADE2 |ADH5 |AGP2 |AIM10 |AIM7 |ATP1 |BUD5 |CBP6 |CCE1 |CCS1 |COX6 |CSE2 |CTR1 |MORE
Reviews	Czabany T, et al. (2007) Synthesis, storage and degradation of neutral lipids in yeast. Biochim Biophys Acta 1771(3):299-309	|ARE1 |DGA1 |GPT2 |LRO1 |SCT1 |TGL1 |TGL3 |TGL4 |TGL5
Reviews	Daum G, et al. (2007) Dynamics of neutral lipid storage and mobilization in yeast. Biochimie 89(2):243-8	|ARE1 |AYR1 |DGA1 |DPP1 |GPT2 |LPP1 |LRO1 |PAH1 |SCT1 |SLC1 |TGL1 |TGL3 |TGL4 |TGL5 |MORE
Cell Growth and Metabolism Reviews	Daum G, et al. (2007) Lipid storage and mobilization pathways in yeast. Novartis Found Symp 286:142-51; discussion 151-4, 162-3, 196-203	|ARE1 |DGA1 |ERG1 |LRO1 |TGL1 |TGL3 |TGL4 |TGL5 |YEH1 |YEH2
Reviews	Kohlwein SD and Petschnigg J (2007) Lipid-induced Cell Dysfunction and Cell Death: Lessons from Yeast. Curr Hypertens Rep 9(6):455-461	|ARE1 |DGA1 |INO1 |LRO1 |NTE1 |OLE1 |OPI1 |PAH1 |SNF1 |TGL3 |TGL4 |TGL5
Protein Physical Properties	White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36	|ALG1 |ALG7 |APQ12 |AQY1 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |COS8 |MORE
Genetic Interactions Mutants/Phenotypes	Bosson R, et al. (2006) GUP1 of Saccharomyces cerevisiae encodes an O-acyltransferase involved in remodeling of the GPI anchor. Mol Biol Cell 17(6):2636-45	|ALE1 |ARE1 |GAS1 |GUP1 |GUP2
Other Features	Maczek J, et al. (2006) Metabolic flux analysis of the sterol pathway in the yeast Saccharomyces cerevisiae. Bioprocess Biosyst Eng 29(4):241-52	|ARE1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |IFA38 |MORE
Protein-protein Interactions	Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60	|ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARG4 |ARR3 |ASG7 |ATG14 |ATG16 |MORE
Reviews	Wagner A and Daum G (2005) Formation and mobilization of neutral lipids in the yeast Saccharomyces cerevisiae. Biochem Soc Trans 33(Pt 5):1174-7	|ARE1 |DGA1 |LRO1 |TGL1 |TGL3 |YEH1 |YEH2
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Kalscheuer R, et al. (2004) Synthesis of novel lipids in Saccharomyces cerevisiae by heterologous expression of an unspecific bacterial acyltransferase. Appl Environ Microbiol 70(12):7119-25	|ARE1 |DGA1 |LRO1
Cellular Location Function/Process Genetic Interactions Regulation of Reviews Substrates/Ligands/Cofactors	Mullner H and Daum G (2004) Dynamics of neutral lipid storage in yeast. Acta Biochim Pol 51(2):323-47	|ARE1 |DGA1 |ERG26 |LRO1 |TGL1 |TGL3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sorger D, et al. (2004) A yeast strain lacking lipid particles bears a defect in ergosterol formation. J Biol Chem 279(30):31190-6	|ARE1 |AYR1 |DGA1 |ERG1 |ERG6 |ERG7 |LRO1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Oelkers P, et al. (2002) The DGA1 gene determines a second triglyceride synthetic pathway in yeast. J Biol Chem 277(11):8877-81	|DGA1 |LRO1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sandager L, et al. (2002) Storage lipid synthesis is non-essential in yeast. J Biol Chem 277(8):6478-82	|ARE1 |DGA1 |LRO1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs Substrates/Ligands/Cofactors Transcription	Valachovic M, et al. (2002) Heme-regulated expression of two yeast acyl-CoA:sterol acyltransferases is involved in the specific response of sterol esterification to anaerobiosis. FEMS Microbiol Lett 206(1):121-5	|ARE1 |HEM1
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Guo Z, et al. (2001) Identification of potential substrate-binding sites in yeast and human acyl-CoA sterol acyltransferases by mutagenesis of conserved sequences. J Lipid Res 42(8):1282-91
Function/Process Fungal Related Genes/Proteins RNA Levels and Processing Regulation of Strains/Constructs Transcription	Jensen-Pergakes K, et al. (2001) Transcriptional regulation of the two sterol esterification genes in the yeast Saccharomyces cerevisiae. J Bacteriol 183(17):4950-7	|ARE1 |HAP1 |ROX1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ness F, et al. (2001) SUT1 is a putative Zn[II]2Cys6-transcription factor whose upregulation enhances both sterol uptake and synthesis in aerobically growing Saccharomyces cerevisiae cells. Eur J Biochem 268(6):1585-95	|HEM1 |SUT1 |SUT2
Function/Process Fungal Related Genes/Proteins Regulation of	Valachovic M, et al. (2001) Anaerobiosis induces complex changes in sterol esterification pattern in the yeast Saccharomyces cerevisiae. FEMS Microbiol Lett 197(1):41-5	|ARE1
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |BNI4 |MORE
Cross-species Expression Function/Process	Bouvier-Nave P, et al. (2000) Expression in yeast and tobacco of plant cDNAs encoding acyl CoA:diacylglycerol acyltransferase. Eur J Biochem 267(1):85-96	|ARE1
Cross-species Expression Non-Fungal Related Genes/Proteins	Bouvier-Nave P, et al. (2000) Expression in yeast of an acyl-CoA:diacylglycerol acyltransferase cDNA from Caenorhabditis elegans. Biochem Soc Trans 28(6):692-5	|ARE1
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12	|ARE1 |GUP1 |GUP2 |LRO1
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Sandager L, et al. (2000) An acyl-CoA:cholesterol acyltransferase (ACAT)-related gene is involved in the accumulation of triacylglycerols in Saccharomyces cerevisiae. Biochem Soc Trans 28(6):700-2	|ARE1
Reviews	Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63	|ARE1 |ARH1 |ARV1 |ECM22 |ERG10 |ERG11 |ERG6 |ERG9 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE
Mutants/Phenotypes Strains/Constructs	Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70	|ARE1 |ARV1
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Zweytick D, et al. (2000) Contribution of Are1p and Are2p to steryl ester synthesis in the yeast Saccharomyces cerevisiae. Eur J Biochem 267(4):1075-82	|ARE1
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |ERG10 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Polakowski T, et al. (1999) Enhanced sterol-acyl transferase activity promotes sterol accumulation in Saccharomyces cerevisiae. Appl Microbiol Biotechnol 53(1):30-5	|HMG1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ness F, et al. (1998) Sterol uptake in Saccharomyces cerevisiae heme auxotrophic mutants is affected by ergosterol and oleate but not by palmitoleate or by sterol esterification. J Bacteriol 180(7):1913-9	|ARE1
Reviews	Wahi M, et al. (1998) Gene regulation by the yeast Ssn6-Tup1 corepressor. Cold Spring Harb Symp Quant Biol 63:447-57	|CYC8 |TUP1
Reviews	Sturley SL (1997) Molecular aspects of intracellular sterol esterification: the acyl coenzyme A: cholesterol acyltransferase reaction. Curr Opin Lipidol 8(3):167-73	|ARE1
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Substrates/Ligands/Cofactors	Yang H, et al. (1997) Functional expression of a cDNA to human acyl-coenzyme A:cholesterol acyltransferase in yeast. Species-dependent substrate specificity and inhibitor sensitivity. J Biol Chem 272(7):3980-5	|ARE1
Function/Process	Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5	|ARE1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Regulatory Role Techniques and Reagents	Yang H, et al. (1996) Sterol esterification in yeast: a two-gene process. Science 272(5266):1353-6	|ARE1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yu C, et al. (1996) Molecular cloning and characterization of two isoforms of Saccharomyces cerevisiae acyl-CoA:sterol acyltransferase. J Biol Chem 271(39):24157-63	|ARE1

Return to SGD

Send a Message to the SGD Curators