---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LRO1/YNR008W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 640399 to 642384 CDS: 640399 - 642384 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LRO1	YNR008W		ORF, Verified	S000005291
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 1999-07-29. Gene name expires on 2000-07-29.
Description
Acyltransferase that catalyzes diacylglycerol esterification; one of several acyltransferases that contribute to triglyceride synthesis; putative homolog of human lecithin cholesterol acyltransferase

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By acyltransferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0012 Assigned on 2007-05-23 UniProtKB phosphatidylcholine-sterol O-acyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003386 Assigned on 2007-05-23 UniProtKB phospholipid:diacylglycerol acyltransferase activity Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12        IDA : Inferred from Direct Assay Assigned on 2002-08-20 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.3.1.158 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By lipid metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003386 Assigned on 2009-10-01 UniProtKB lipid storage Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2002-08-16 SGD triglyceride biosynthetic process Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2002-08-16 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Sorger D and Daum G (2002) Synthesis of triacylglycerols by the acyl-coenzyme A:diacyl-glycerol acyltransferase Dga1p in lipid particles of the yeast Saccharomyces cerevisiae. J Bacteriol 184(2):519-24        TAS : Traceable Author Statement Assigned on 2002-08-16 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9904 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
triglyceride biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forLRO1/YNR008W for LRO1 1) Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LRO1/YNR008W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LRO1/YNR008W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MGTLFRR C-term SQMPFPM Length(aa) 661 MW(Da) 75,393 pI 6.67 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.057   Codon Adaptation Index 0.134   Frequency of Optimal Codons 0.435   Hydropathicity of Protein -0.522   Aromaticity Score 0.107

10 20 30 40 50 | | | | | MGTLFRRNVQNQKSDSDENNKGGSVHNKRESRNHIHHQQGLGHKRRRGIS GSAKRNERGKDFDRKRDGNGRKRWRDSRRLIFILGAFLGVLLPFSFGAYH VHNSDSDLFDNFVNFDSLKVYLDDWKDVLPQGISSFIDDIQAGNYSTSSL DDLSENFAVGKQLLRDYNIEAKHPVVMVPGVISTGIESWGVIGDDECDSS AHFRKRLWGSFYMLRTMVMDKVCWLKHVMLDPETGLDPPNFTLRAAQGFE STDYFIAGYWIWNKVFQNLGVIGYEPNKMTSAAYDWRLAYLDLERRDRYF TKLKEQIELFHQLSGEKVCLIGHSMGSQIIFYFMKWVEAEGPLYGNGGRG WVNEHIDSFINAAGTLLGAPKAVPALISGEMKDTIQLNTLAMYGLEKFFS RIERVKMLQTWGGIPSMLPKGEEVIWGDMKSSSEDALNNNTDTYGNFIRF ERNTSDAFNKNLTMKDAINMTLSISPEWLQRRVHEQYSFGYSKNEEELRK NELHHKHWSNPMEVPLPEAPHMKIYCIYGVNNPTERAYVYKEEDDSSALN LTIDYESKQPVFLTEGDGTVPLVAHSMCHKWAQGASPYNPAGINVTIVEM KHQPDRFDIRGGAKSAEHVDILGSAELNDYILKIASGNGDLVEPRQLSNL SQWVSQMPFPM*

Protein Structures from PDB: proteins of known structure with sequence similarity to LRO1/YNR008W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
LRO1	2001-05-03	Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNR008W	SGD Systematic Sequence
855742	NCBI: Gene ID
NP_014405.1	NCBI: RefSeq protein version ID
NP_014405.1	NCBI: RefSeq protein version ID
6324335	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
36 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes	Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151	|ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |FEN1 |MORE
Reviews	Kohlwein SD (2010) Obese and anorexic yeasts: Experimental models to understand the metabolic syndrome and lipotoxicity. Biochim Biophys Acta	|ACC1 |ALE1 |ARE1 |ARE2 |DGA1 |FAA1 |FAA2 |FAA3 |FAA4 |FAT1 |GPT2 |MGA2 |MIG1 |OLE1 |MORE
Genetic Interactions Strains/Constructs Techniques and Reagents Transcription	Fei W, et al. (2009) Conditions of endoplasmic reticulum stress stimulate lipid droplet formation in Saccharomyces cerevisiae. Biochem J 424(1):61-7	|ANP1 |ARE1 |ARE2 |DGA1 |ERD1 |HRD1 |IRE1 |MNN10 |MNN11 |OCH1 |OST4 |PMR1 |SSM4
Reviews	Garbarino J and Sturley SL (2009) Saturated with fat: new perspectives on lipotoxicity. Curr Opin Clin Nutr Metab Care 12(2):110-6	|ARE1 |ARE2 |DGA1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Garbarino J, et al. (2009) Sterol and diacylglycerol acyltransferase deficiency triggers fatty acid-mediated cell death. J Biol Chem 284(45):30994-1005	|ARE1 |ARE2 |BFR1 |CHO2 |DGA1 |DGK1 |GET1 |GET2 |GET3 |ICE2 |OPI3 |RDL1 |SFB2 |TSC3
Strains/Constructs	Mavraganis I, et al. (2009) A type II diacylglycerol acyltransferase from Claviceps purpurea with substrate preference towards ricinoleic acid, a hydroxyl fatty acid of industrial importance. Appl Environ Microbiol	|ARE1 |ARE2 |DGA1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Petschnigg J, et al. (2009) Good fat, essential cellular requirements for triacylglycerol synthesis to maintain membrane homeostasis in yeast. J Biol Chem 284(45):30981-93	|ARE1 |ARE2 |DGA1 |IRE1
Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Siloto RM, et al. (2009) Simple methods to detect triacylglycerol biosynthesis in a yeast-based recombinant system. Lipids 44(10):963-73	|ARE1 |ARE2 |DGA1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Spanova M, et al. (2009) Effect of lipid particle biogenesis on the subcellular distribution of squalene in the yeast Saccharomyces cerevisiae. J Biol Chem	|ARE1 |ARE2 |DGA1 |HEM1
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Czabany T, et al. (2008) Structural and Biochemical Properties of Lipid Particles from the Yeast Saccharomyces cerevisiae. J Biol Chem 283(25):17065-17074	|ARE1 |ARE2 |DGA1 |ERG1 |POR1 |PRC1 |WBP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaspar ML, et al. (2008) A Block in Endoplasmic Reticulum-to-Golgi Trafficking Inhibits Phospholipid Synthesis and Induces Neutral Lipid Accumulation. J Biol Chem 283(37):25735-51	|ARE2 |DGA1 |HAC1 |SEC13 |SEC31 |SEC6
Mutants/Phenotypes Strains/Constructs	Stalberg K, et al. (2008) Identification of a novel GPCAT activity and a new pathway for phosphatidylcholine biosynthesis in S. cerevisiae. J Lipid Res 49(8):1794-806	|ALE1 |ARE1 |ARE2 |CST26 |DGA1 |GDE1 |GIT1 |GPT2 |GUP1 |HNM1 |MUM3 |PCT1 |PEP7 |PMC1 |MORE
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Xu J, et al. (2008) Cloning and characterization of an acyl-CoA-dependent diacylglycerol acyltransferase 1 (DGAT1) gene from Tropaeolum majus, and a study of the functional motifs of the DGAT protein using site-directed mutagenesis to modify enzyme activity and oil content. Plant Biotechnol J 6(8):799-818	|ARE1 |ARE2 |DGA1
Reviews	Czabany T, et al. (2007) Synthesis, storage and degradation of neutral lipids in yeast. Biochim Biophys Acta 1771(3):299-309	|ARE1 |ARE2 |DGA1 |GPT2 |SCT1 |TGL1 |TGL3 |TGL4 |TGL5
Reviews	Daum G, et al. (2007) Dynamics of neutral lipid storage and mobilization in yeast. Biochimie 89(2):243-8	|ARE1 |ARE2 |AYR1 |DGA1 |DPP1 |GPT2 |LPP1 |PAH1 |SCT1 |SLC1 |TGL1 |TGL3 |TGL4 |TGL5 |MORE
Cell Growth and Metabolism Reviews	Daum G, et al. (2007) Lipid storage and mobilization pathways in yeast. Novartis Found Symp 286:142-51; discussion 151-4, 162-3, 196-203	|ARE1 |ARE2 |DGA1 |ERG1 |TGL1 |TGL3 |TGL4 |TGL5 |YEH1 |YEH2
Cross-species Expression Function/Process Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Ghosal A, et al. (2007) Saccharomyces cerevisiae phospholipid:diacylglycerol acyl transferase (PDAT) devoid of its membrane anchor region is a soluble and active enzyme retaining its substrate specificities. Biochim Biophys Acta 1771(12):1457-63
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kamisaka Y, et al. (2007) DGA1 (diacylglycerol acyltransferase gene) overexpression and leucine biosynthesis significantly increase lipid accumulation in the Deltasnf2 disruptant of Saccharomyces cerevisiae. Biochem J 408(1):61-8	|DGA1 |FAA1 |FAA2 |FAA3 |FAA4 |LEU2 |SNF2
Reviews	Kohlwein SD and Petschnigg J (2007) Lipid-induced Cell Dysfunction and Cell Death: Lessons from Yeast. Curr Hypertens Rep 9(6):455-461	|ARE1 |ARE2 |DGA1 |INO1 |NTE1 |OLE1 |OPI1 |PAH1 |SNF1 |TGL3 |TGL4 |TGL5
DNA/RNA Sequence Features	Steigele S, et al. (2007) Comparative analysis of structured RNAs in S. cerevisiae indicates a multitude of different functions. BMC Biol 5:25	|AIM5 |ALR1 |AMA1 |ARC40 |ARG1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ASR1 |ATP2 |BMH1 |BMH2 |BRP1 |MORE
Reviews	Wagner A and Daum G (2005) Formation and mobilization of neutral lipids in the yeast Saccharomyces cerevisiae. Biochem Soc Trans 33(Pt 5):1174-7	|ARE1 |ARE2 |DGA1 |TGL1 |TGL3 |YEH1 |YEH2
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Kalscheuer R, et al. (2004) Synthesis of novel lipids in Saccharomyces cerevisiae by heterologous expression of an unspecific bacterial acyltransferase. Appl Environ Microbiol 70(12):7119-25	|ARE1 |ARE2 |DGA1
Cellular Location Function/Process Genetic Interactions Regulation of Reviews Substrates/Ligands/Cofactors	Mullner H and Daum G (2004) Dynamics of neutral lipid storage in yeast. Acta Biochim Pol 51(2):323-47	|ARE1 |ARE2 |DGA1 |ERG26 |TGL1 |TGL3
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sorger D, et al. (2004) A yeast strain lacking lipid particles bears a defect in ergosterol formation. J Biol Chem 279(30):31190-6	|ARE1 |ARE2 |AYR1 |DGA1 |ERG1 |ERG6 |ERG7
Non-Fungal Related Genes/Proteins	Stahl U, et al. (2004) Cloning and functional characterization of a phospholipid:diacylglycerol acyltransferase from Arabidopsis. Plant Physiol 135(3):1324-35
Reviews	Sorger D and Daum G (2003) Triacylglycerol biosynthesis in yeast. Appl Microbiol Biotechnol 61(4):289-99	|DGA1
Mutants/Phenotypes Strains/Constructs	Volckaert G, et al. (2003) Disruption of 12 ORFs located on chromosomes IV, VII and XIV of Saccharomyces cerevisiae reveals two essential genes. Yeast 20(1):79-88	|ATG3 |ERV29 |FLC3 |HUL5 |LST8 |NRM1 |PHO91 |PXR1 |YDL183C |YGL140C |YNR004W
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Oelkers P, et al. (2002) The DGA1 gene determines a second triglyceride synthetic pathway in yeast. J Biol Chem 277(11):8877-81	|ARE2 |DGA1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sandager L, et al. (2002) Storage lipid synthesis is non-essential in yeast. J Biol Chem 277(8):6478-82	|ARE1 |ARE2 |DGA1
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Sorger D and Daum G (2002) Synthesis of triacylglycerols by the acyl-coenzyme A:diacyl-glycerol acyltransferase Dga1p in lipid particles of the yeast Saccharomyces cerevisiae. J Bacteriol 184(2):519-24	|DGA1 |FAA1 |FAA4
Non-Fungal Related Genes/Proteins	Dahlqvist A, et al. (2000) Phospholipid:diacylglycerol acyltransferase: an enzyme that catalyzes the acyl-CoA-independent formation of triacylglycerol in yeast and plants. Proc Natl Acad Sci U S A 97(12):6487-92
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Oelkers P, et al. (2000) A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast. J Biol Chem 275(21):15609-12	|ARE1 |ARE2 |GUP1 |GUP2
Reviews	Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63	|ARE1 |ARE2 |ARH1 |ARV1 |ECM22 |ERG10 |ERG11 |ERG6 |ERG9 |HMG1 |HMG2 |HMS1 |NCR1 |ROX1 |MORE
Non-Fungal Related Genes/Proteins	Peelman F, et al. (1998) A proposed architecture for lecithin cholesterol acyl transferase (LCAT): identification of the catalytic triad and molecular modeling. Protein Sci 7(3):587-99
DNA/RNA Sequence Features	Verhasselt P, et al. (1994) Twelve open reading frames revealed in the 23.6 kb segment flanking the centromere on the Saccharomyces cerevisiae chromosome XIV right arm. Yeast 10(10):1355-61	|ADY2 |ATG3 |ATO2 |CIT1 |CSE2 |NRM1 |PRP2 |RPC34 |SIS1 |URK1 |VPS27

Return to SGD

Send a Message to the SGD Curators