EGT2/YNL327W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIV: 24047 to 27172
CDS: 24047 - 27172

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

EGT2 YNL327W ORF, Verified S000005271

Description
Glycosylphosphatidylinositol (GPI)-anchored cell wall endoglucanase required for proper cell separation after cytokinesis, expression is activated by Swi5p and tightly regulated in a cell cycle-dependent manner

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
cellulase activity Pan X and Heitman J (2000) Sok2 regulates yeast pseudohyphal differentiation via a transcription factor cascade that regulates cell-cell adhesion. Mol Cell Biol 20(22):8364-72
       TAS : Traceable Author Statement
Assigned on 2002-12-09 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0132
Assigned on 2007-05-23 UniProtKB
cytokinesis Kovacech B, et al. (1996) EGT2 gene transcription is induced predominantly by Swi5 in early G1. Mol Cell Biol 16(7):3264-74
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-12-09 SGD
mitosis GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0498
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
anchored to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0336
Assigned on 2009-05-05 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9902
Assigned on 2009-10-01 UniProtKB
cell septum Fujita M, et al. (2004) GPI7 involved in glycosylphosphatidylinositol biosynthesis is essential for yeast cell separation. J Biol Chem 279(50):51869-79
       IDA : Inferred from Direct Assay
Assigned on 2009-12-17 SGD
cell wall GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0134
Assigned on 2009-05-05 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0041
Assigned on 2009-05-06 UniProtKB
cellular bud Shepard KA, et al. (2003) Widespread cytoplasmic mRNA transport in yeast: identification of 22 bud-localized transcripts using DNA microarray analysis. Proc Natl Acad Sci U S A 100(20):11429-34
         IDA : Inferred from Direct Assay
Assigned on 2006-11-03 SGD
extracellular region GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0964
Assigned on 2009-06-29 UniProtKB
fungal-type cell wall Hamada K, et al. (1999) Amino acid residues in the omega-minus region participate in cellular localization of yeast glycosylphosphatidylinositol-attached proteins. J Bacteriol 181(13):3886-9
       IDA : Inferred from Direct Assay
Assigned on 2002-06-17 SGD
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forEGT2/YNL327W for EGT2
1) Kovacech B, et al. (1996) EGT2 gene transcription is induced predominantly by Swi5 in early G1. Mol Cell Biol 16(7):3264-74

2) Pan X and Heitman J (2000) Sok2 regulates yeast pseudohyphal differentiation via a transcription factor cascade that regulates cell-cell adhesion. Mol Cell Biol 20(22):8364-72

3) Terashima H, et al. (2003) The localization change of Ybr078w/Ecm33, a yeast GPI-associated protein, from the plasma membrane to the cell wall, affecting the cellular function. FEMS Microbiol Lett 218(1):175-80

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for EGT2/YNL327W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for EGT2/YNL327W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNKLLLH

C-term GLISFLL

Length(aa) 1,041

MW(Da) 108,494

pI 4.52

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.143

Codon Adaptation Index 0.153

Frequency of Optimal Codons 0.496

Hydropathicity of Protein -0.063

Aromaticity Score 0.066

10 20 30 40 50 | | | | | MNKLLLHLVRVISILGLANALTQTQPILKDIQITDSYTKTKECTDPDHWF IIEGQLSIPKGSQQNITFQVPDAFSSFPQEPFSIKHNSNSVATISRPDKS TNNFTISIPEKSSEDITTTFNFLAQLTSDAKSKVTEPKSIVYSFYSENTM FNDVIDYVAKNTSAITTDGGIYKTNNTAWFTVDLPMRTFRNPVYLTSQTS SSSDYVFDTSLTKFEVVTAVDSFNEPINAIPYTTVHDYSTEDEIRCLFNS TISGGLYFRVTYFTKKLSTSSISNTVELTYPDEGTSVRLLGKRDTSTTLA SELYSESAANIDSTTSDDTTSSDAAITPTYSNSTLSSYTSQSSAIPEVAV TASLSSGILSSTVDGASTSADASMSAVSTVSSSSEQASSSSISLSAPSSS NSTFTTPSSSLSATETYSIISSASISVTQASYIDNSTTTAVTQSTSTIAV SSAEKLSSTLSYTSNVTISVSSATQHTTTPSYVSNSTTLSSSSVLESVIS SPYLANTTVSGASSASQSTNPPYVSNSTTSSATQLATIAPFAINITGTSI SSSITNTSSVSSTTSSLSSGPFVSNTAVASGSYILTTTTESAQLTEIGSL IPISTITTSTTTSGTDKTGSNKVASSTEIAQSIVNNSSLSVSTINTNAAT AAANARNATFTHATHSGSLQPSYHSSSLLSSTIDTKVTTATTSTSRDGSS SLAFTTGLNQSVVTGTDKSDTYSVISSTESAQVTEYDSLLPISTLKPTVV TGTSRNSTFSMVSSTKLTEATATDKGDAYSVISSTQSAQVTEYGSMLPIS TLETPTVIMSTDESGYFTLTTCTESGQATEYGSLIPISTLDGSVIYTFTG ESVVVGYSTTVGAAQYAQHTSLVPVSTIKGSKTSLSTEESVVAGYSTTVG AAQYAQHTSLVPVSTIKGSKTSLSTEESVVAGYSTTVDSAQYAEHTNLVA IDTLKTSTFQKATATEVCVTCTALSSPHSATLDAGTTISLPTSSSTSLST IITWYSSSTIKPPSISTYSGAAGQLTIRIGSLLLGLISFLL*

Protein Structures from PDB: proteins of known structure with sequence similarity to EGT2/YNL327W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to EGT2 Homolog Source (per PDB) Protein Alignment: EGT2 vs. Homolog External Links
P-Value %Identical %Similar Alignment
3h0g ( Chain: A, M)
DNA-directed RNA polym
PDB_Info
PDB_Structure
Unknown Chain A = 0.004300 30 22 View alignment SCOP
MMDB
CATH
Chain M = 0.004300 30 22 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
EGT2 SGD (2007) Information without a citation in SGD

Standard Name	Reference
EGT2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YNL327W SGD Systematic Sequence

855389 NCBI: Gene ID

NP_014072.1 NCBI: RefSeq protein version ID

NP_014072.1 NCBI: RefSeq protein version ID

6324002 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YNL327W	SGD Systematic Sequence
855389	NCBI: Gene ID
NP_014072.1	NCBI: RefSeq protein version ID
NP_014072.1	NCBI: RefSeq protein version ID
6324002	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
30 curated references; 0 references not yet curated
Reviews
Fujita M and Jigami Y (2008) Lipid remodeling of GPI-anchored proteins and its function. Biochim Biophys Acta 1780(3):410-20
       |BST1 |CDC42 |CWH43 |EMP24 |ERI1 |ERV25 |FUR4 |GAS1 |GPI10 |GUP1 |GWT1 |IRE1 |LAS21 |MCD4 |MORE
Cellular Location
Hasegawa Y, et al. (2008) Distinct roles for Khd1p in the localization and expression of bud-localized mRNAs in yeast. RNA 14(11):2333-47
       |ASH1 |CLB2 |HEK2 |IST2 |MID2 |MTL1 |SRL1 |WSC2
Cellular Location
Protein Processing/Modification/Regulation
Regulation of
Jigami Y (2008) Biosynthetic Pathway of GPI-anchored Cell Wall Mannoproteins in Yeast as a Potential Target for Anti-fungal and Anti-cancer Drugs. Nippon Ishinkin Gakkai Zasshi 49(4):253-62
       |GWT1 |LAS21 |PER1
Regulation of
Transcription
Rojas M, et al. (2008) Genomewide expression profiling of cryptolepine-induced toxicity in Saccharomyces cerevisiae. Antimicrob Agents Chemother 52(11):3844-50
       |AFT1 |ALD3 |ARN1 |ARN2 |CCP1 |CDC19 |CIS3 |CTT1 |DAN1 |ECM33 |ENO2 |ERG6 |ERV1 |EXG2 |MORE
Evolution
Fungal Related Genes/Proteins
Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77
       |ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
RNA Levels and Processing
Regulation of
Dardalhon M, et al. (2007) Specific transcriptional responses induced by 8-methoxypsoralen and UVA in yeast. FEMS Yeast Res 7(6):866-878
       |AAD6 |ARG3 |ARG5,6 |ARG80 |BCH2 |CDC27 |CDC45 |COT1 |CTF19 |DDI2 |DIN7 |DUN1 |ECL1 |ECM13 |MORE
Cell Cycle Phase Involved
DNA/RNA Sequence Features
RNA Levels and Processing
Transcription
Voth WP, et al. (2007) Forkhead proteins control the outcome of transcription factor binding by antiactivation. EMBO J 26(20):4324-34
         |ACE2 |AIM44 |AMN1 |ASH1 |BAR1 |BUD9 |CDC6 |CLB2 |CTS1 |DSE1 |DSE2 |DSE3 |DSE4 |FAA3 |MORE
RNA Levels and Processing
Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42
           |AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Mutants/Phenotypes
Kawahata M, et al. (2006) Yeast genes involved in response to lactic acid and acetic acid: acidic conditions caused by the organic acids in Saccharomyces cerevisiae cultures induce expression of intracellular metal metabolism genes regulated by Aft1p. FEMS Yeast Res 6(6):924-36
         |AFT1 |ARN1 |ARN2 |ATO3 |COT1 |CTS1 |DAK2 |DAL5 |DSE2 |EAF1 |EAF3 |EAF5 |EAF6 |FET3 |MORE
Reviews
Klis FM, et al. (2006) Cell wall construction in Saccharomyces cerevisiae. Yeast 23(3):185-202
       |AGA1 |BGL2 |CHS1 |CHS2 |CHS3 |CIS3 |CLB2 |CLN2 |CRH1 |CTS1 |CWP1 |CWP2 |DAN1 |DAN4 |MORE
Reviews
Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43
       |ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS1 |MORE
Regulation of
Transcription
Purevdorj-Gage B, et al. (2006) Effects of low-shear modeled microgravity on cell function, gene expression, and phenotype in Saccharomyces cerevisiae. Appl Environ Microbiol 72(7):4569-75
       |BUD25 |BUD5 |DSE1 |DSE2 |DSE4 |RAX1 |RAX2
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Transcription
Slattery MG, et al. (2006) The function and properties of the Azf1 transcriptional regulator change with growth conditions in Saccharomyces cerevisiae. Eukaryot Cell 5(2):313-20
           |ADK2 |ADY3 |AIM20 |ANS1 |AQR1 |ARI1 |AZF1 |CIS3 |CLN1 |CLN3 |CPA1 |CRF1 |CSI2 |CYS3 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Svarovsky MJ and Palecek SP (2005) Disruption of LRG1 inhibits mother-daughter separation in Saccharomyces cerevisiae. Yeast 22(14):1117-32
       |DSE4 |FKS1 |FLO8 |LRG1 |ROM2 |STE12
DNA/RNA Sequence Features
Verstrepen KJ, et al. (2005) Intragenic tandem repeats generate functional variability. Nat Genet 37(9):986-90
       |AGA1 |BMH2 |BSC1 |CDC27 |CHS5 |CTR1 |DAN4 |DDR48 |FIT1 |FLO1 |FLO10 |FLO5 |FLO9 |FUN12 |MORE
RNA Levels and Processing
Regulation of
Voth WP, et al. (2005) ACE2, CBK1, and BUD4 in budding and cell separation. Eukaryot Cell 4(6):1018-28
             |ACE2 |BUD4 |CBK1 |CTS1 |DSE2 |HYM1 |KIC1 |MOB2 |SCW11 |SWI5
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Fujita M, et al. (2004) GPI7 involved in glycosylphosphatidylinositol biosynthesis is essential for yeast cell separation. J Biol Chem 279(50):51869-79
       |ACE2 |BGL2 |CBK1 |CDC5 |DSE4 |GFA1 |LAS21 |RHO2 |ROM2 |SLG1
Cellular Location
Other Features
Strains/Constructs
Shepard KA, et al. (2003) Widespread cytoplasmic mRNA transport in yeast: identification of 22 bud-localized transcripts using DNA microarray analysis. Proc Natl Acad Sci U S A 100(20):11429-34
         |ASH1 |BRO1 |CLB2 |CPS1 |DNM1 |EAR1 |ERG2 |IRC8 |IST2 |KSS1 |MET4 |MID2 |MMR1 |MTL1 |MORE
Cellular Location
Protein Sequence Features
Strains/Constructs
Terashima H, et al. (2003) The localization change of Ybr078w/Ecm33, a yeast GPI-associated protein, from the plasma membrane to the cell wall, affecting the cellular function. FEMS Microbiol Lett 218(1):175-80
         |ECM33 |FIT1
Regulation of
Transcription
Zhang L, et al. (2002) Expression profiling of the response of Saccharomyces cerevisiae to 5-fluorocytosine using a DNA microarray. Int J Antimicrob Agents 20(6):444-50
           |CTS1
Cell Cycle Phase Involved
RNA Levels and Processing
Regulation of
Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708
               |ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD4 |BUD8 |BUD9 |CDC20 |CDC21 |CDC45 |CDC6 |MORE
Function/Process
Regulation of
Pan X and Heitman J (2000) Sok2 regulates yeast pseudohyphal differentiation via a transcription factor cascade that regulates cell-cell adhesion. Mol Cell Biol 20(22):8364-72
       |ASH1 |CLB1 |CLB2 |CTS1 |FLO8 |MUC1 |PHD1 |SOK2 |SWI5 |TPK1 |TPK2 |TPK3
RNA Levels and Processing
Braley R and Chaffin WL (1999) Variations in mRNA transcript levels of cell wall-associated genes of Saccharomyces cerevisiae following spheroplasting. FEMS Microbiol Lett 181(1):177-85
       |CRH1 |EXO1 |FLO1 |HKR1 |KRE1 |KRE11 |KRE5 |MSN1 |MUC1 |PMT2 |SEC53 |SED1 |SKT5 |TIR1
Cell Cycle Phase Involved
Regulation of
Transcription
McBride HJ, et al. (1999) Distinct regions of the Swi5 and Ace2 transcription factors are required for specific gene activation. J Biol Chem 274(30):21029-36
       |ACE2 |ASH1 |CDC6 |CTS1 |HO |PCL2 |PCL9 |PHO2 |RME1 |SIC1 |SWI5
RNA Levels and Processing
Regulation of
Gray NS, et al. (1998) Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science 281(5376):533-8
         |ACH1 |ATR1 |BDH2 |CAK1 |CDC28 |CLB1 |CLB2 |CTS1 |CTT1 |CYC3 |DSE2 |FAR1 |GPG1 |GPH1 |MORE
Cellular Location
Fungal Related Genes/Proteins
Protein Sequence Features
Hamada K, et al. (1998) Screening for glycosylphosphatidylinositol (GPI)-dependent cell wall proteins in Saccharomyces cerevisiae. Mol Gen Genet 258(1-2):53-9
     |CCW12 |CRH1 |DAN4 |FIT1 |PRY3 |SAG1 |SED1 |SPI1 |TIR4 |TOS6 |UTR2 |YDR134C |YJL171C |YNL190W |MORE
Mutants/Phenotypes
Strains/Constructs
Maftahi M, et al. (1998) Generation of Saccharomyces cerevisiae deletants and basic phenotypic analysis of eight novel genes from the left arm of chromosome XIV. Yeast 14(3):271-80
       |KRI1 |LEM3 |PFA3 |PFS2 |STB1 |VNX1 |YNL313C
Cell Cycle Phase Involved
Schuster T, et al. (1997) New cell cycle-regulated genes in the yeast Saccharomyces cerevisiae. Recent Results Cancer Res 143:251-61

Function/Process
RNA Levels and Processing
Transcription
Jansen RP, et al. (1996) Mother cell-specific HO expression in budding yeast depends on the unconventional myosin myo4p and other cytoplasmic proteins. Cell 84(5):687-97
       |ASH1 |BNI1 |HO |MYO4 |SHE2 |SHE3 |SHE4
Cell Cycle Phase Involved
DNA/RNA Sequence Features
Function/Process
Regulation of
Transcription
Kovacech B, et al. (1996) EGT2 gene transcription is induced predominantly by Swi5 in early G1. Mol Cell Biol 16(7):3264-74
       |ACE2 |CTS1 |HO |SWI5

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.