---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG24/YNL280C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 110411 to 109095 CDS: 110411 - 109095 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG24	YNL280C		ORF, Verified	S000005224
Description
C-14 sterol reductase, acts in ergosterol biosynthesis; mutants accumulate the abnormal sterol ignosterol (ergosta-8,14 dienol), and are viable under anaerobic growth conditions but inviable on rich medium under aerobic conditions

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By delta14-sterol reductase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:1.3.1.70 Assigned on 2007-05-23 UniProtKB oxidoreductase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By alcohol metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular lipid metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular metabolic compound salvage Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT ergosterol biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2007-05-23 UniProtKB oxidation reduction GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB steroid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0752 Assigned on 2007-05-23 UniProtKB sterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0756 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001171 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG24/YNL280C for ERG24 ERG24 encodes C-14 sterol reductase, an enzyme that acts in ergosterol biosynthesis (1, 2, 3, 4). Cells lacking ERG24 accumulate the abnormal sterol ignosterol (ergosta-8,14 dienol), and are viable under anaerobic growth conditions, but cannot grow on rich (YPD) medium under aerobic conditions (1, 5, 6, 7). On defined media, or on YPD supplemented with calcium, erg24 mutants can grow aerobically (7, 8). Erg24p is a target of morpholine antifungals, and erg24 mutations confer resistance to these drugs (9, 8). Expression of ERG9, which encodes farnesyl-diphosphate farnesyl transferase, is increased in erg24 mutants (10). An ERG24 homolog has been cloned in S. pombe (11), and the human lamin B receptor contains a domain similar to sterol reductases, and can complement the erg24 null phenotype (12). Last Updated: 2000-09-01

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG24/YNL280C for ERG24 1) Lorenz RT and Parks LW (1992) Cloning, sequencing, and disruption of the gene encoding sterol C-14 reductase in Saccharomyces cerevisiae. DNA Cell Biol 11(9):685-92      2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6      4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30      5) Marcireau C, et al. (1992) Construction and growth properties of a yeast strain defective in sterol 14-reductase. Curr Genet 22(4):267-72      6) Bard M, et al. (1993) Sterol synthesis and viability of erg11 (cytochrome P450 lanosterol demethylase) mutations in Saccharomyces cerevisiae and Candida albicans. Lipids 28(11):963-7      7) Crowley JH, et al. (1996) Aerobic isolation of an ERG24 null mutant of Saccharomyces cerevisiae. J Bacteriol 178(10):2991-3        8) Crowley JH, et al. (1998) A calcium-dependent ergosterol mutant of Saccharomyces cerevisiae. Curr Genet 34(2):93-9        9) Lai MH, et al. (1994) The identification of a gene family in the Saccharomyces cerevisiae ergosterol biosynthesis pathway. Gene 140(1):41-9      10) Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22      11) Smith S (1995) Cloning and sequence analysis of an ERG24 homolog from Schizosaccharomyces pombe. Gene 155(1):139-40        12) Silve S, et al. (1998) Human lamin B receptor exhibits sterol C14-reductase activity in Saccharomyces cerevisiae. Biochim Biophys Acta 1392(2-3):233-44

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG24/YNL280C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG24/YNL280C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVSALNP C-term KIIPYVY Length(aa) 438 MW(Da) 50,615 pI 9.4 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.132   Codon Adaptation Index 0.155   Frequency of Optimal Codons 0.477   Hydropathicity of Protein 0.213   Aromaticity Score 0.151

10 20 30 40 50 | | | | | MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQN FDIVELWNGIKPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQL RDGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCII SILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIG RELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKTGKINDALVLV NFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQAR YLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQ TKRGTKLLCDGWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFA TLLLHRQQRDEHKCRLKYGENWEEYERKVPYKIIPYVY*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG24/YNL280C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG24	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNL280C	SGD Systematic Sequence
855441	NCBI: Gene ID
NP_014119.1	NCBI: RefSeq protein version ID
NP_014119.1	NCBI: RefSeq protein version ID
6324049	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
58 curated references; 0 references not yet curated
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Substrates/Ligands/Cofactors	Smith AM, et al. (2009) Quantitative phenotyping via deep barcode sequencing. Genome Res 19(10):1836-42	|ALG7 |ERG11 |SSL2
Mutants/Phenotypes Strains/Constructs	Teixeira MC, et al. (2009) Genome-wide identification of Saccharomyces cerevisiae genes required for maximal tolerance to ethanol. Appl Environ Microbiol 75(18):5761-72	|AGP2 |ANP1 |ARC35 |BDP1 |BNA1 |CSL4 |CUP5 |CWC25 |ERG2 |FHL1 |FPS1 |GCN4 |GCR1 |GLY1 |MORE
Function/Process Mutants/Phenotypes	Abe F and Minegishi H (2008) Global screening of genes essential for growth in high-pressure and cold environments: searching for basic adaptive strategies using a yeast deletion library. Genetics 178(2):851-72	|ACO1 |AGP1 |AGP2 |AGP3 |AKR1 |ALP1 |ARD1 |ARG82 |ARO1 |ARO2 |ATP15 |AVL9 |BAP2 |BAP3 |MORE
Mutants/Phenotypes Strains/Constructs	Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88	|CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG5 |ERG6 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MNN11 |MORE
RNA Levels and Processing Regulation of	Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Mutants/Phenotypes	Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90	|ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Cross-species Expression Disease Gene Related Mutants/Phenotypes Strains/Constructs	Zabrocki P, et al. (2008) Phosphorylation, lipid raft interaction and traffic of alpha-synuclein in a yeast model for Parkinson. Biochim Biophys Acta 1783(10):1767-80	|CKA1 |CKA2 |CKB1 |CKB2 |DOA4 |ERG28 |ERG6 |MAK3 |MDM20 |NAT3 |PEP12 |PKH1 |PKH2 |RVS161 |MORE
Mutants/Phenotypes Strains/Constructs	Ando A, et al. (2007) Identification and classification of genes required for tolerance to freeze-thaw stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. FEMS Yeast Res 7(2):244-53	|AIM4 |AKR1 |ANP1 |BRE1 |BUD19 |CKB2 |CTF4 |CUP5 |DEG1 |DIA2 |EOS1 |FAB1 |GAS1 |GRR1 |MORE
Mutants/Phenotypes	Cheng V, et al. (2007) Genome-Wide Screen for Oxalate-Sensitive Mutants of Saccharomyces cerevisiae. Appl Environ Microbiol 73(18):5919-27	|ADA2 |AFT1 |CCR4 |CDC40 |CNM67 |CTK3 |DRS2 |ERG2 |GLY1 |GON7 |HOM6 |KEM1 |MCH5 |MTQ2 |MORE
Mutants/Phenotypes Strains/Constructs	Liao C, et al. (2007) Genomic Screening in Vivo Reveals the Role Played by Vacuolar H+ ATPase and Cytosolic Acidification in Sensitivity to DNA-Damaging Agents Such as Cisplatin. Mol Pharmacol 71(2):416-25	|ASF1 |ATP2 |BUD31 |BUR2 |CLB2 |CTF18 |CTF4 |CTF8 |DBF2 |DCC1 |DOC1 |EAP1 |GCN5 |GUP1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Shah Alam Bhuiyan M, et al. (2007) Synthetically lethal interactions involving loss of the yeast ERG24: the sterol C-14 reductase gene. Lipids 42(1):69-76	|ERG2 |ERG28 |ERG3 |ERG6 |SUR4
Infection and Antifungals Reviews	Carrillo-Munoz AJ, et al. (2006) Antifungal agents: mode of action in yeast cells. Rev Esp Quimioter 19(2):130-9	|ERG11 |ERG2
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Genetic Interactions	Warringer J and Blomberg A (2006) Involvement of yeast YOL151W/GRE2 in ergosterol metabolism. Yeast 23(5):389-98	|BGL2 |ENO1 |ERG10 |ERG11 |ERG2 |ERG6 |GRE2 |HMG1 |HMG2 |HXK1 |MVD1 |RNR4 |TDH1
Mutants/Phenotypes	Flaherty P, et al. (2005) A latent variable model for chemogenomic profiling. Bioinformatics 21(15):3286-93	|ARC18 |CDC21 |DFR1 |DIA4 |DIS3 |ERG11 |ERG13 |FKS1 |FOL1 |FOL2 |GCD2 |HMG1 |LCB1 |MAL11 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |IFA38 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG1 |ERG11 |ERG2 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9
RNA Levels and Processing	Shobayashi M, et al. (2005) Effects of Culture Conditions on Ergosterol Biosynthesis by Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(12):2381-8	|ERG13 |ERG2 |ERG20 |ERG26 |ERG28 |ERG3 |ERG5 |ERG6 |HMG1
Genetic Interactions Mutants/Phenotypes	Giaever G, et al. (2004) Chemogenomic profiling: identifying the functional interactions of small molecules in yeast. Proc Natl Acad Sci U S A 101(3):793-8	|DFR1 |ERG11 |ERG13 |ERG2 |FOL1 |FOL2 |HMG1 |HMG2 |MAL11 |MUS81 |NEO1 |PSO2 |RAD1 |RAD10 |MORE
RNA Levels and Processing Regulation of	Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31	|BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG26 |ERG27 |ERG3 |ERG6 |MORE
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG25 |ERG26 |MORE
Genomic expression study RNA Levels and Processing Regulation of	Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55	|AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Wagner N, et al. (2004) The lamin B receptor of Drosophila melanogaster. J Cell Sci 117(Pt 10):2015-28
Regulation of Transcription	Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015	|AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Gupta SS, et al. (2003) Antifungal activity of amiodarone is mediated by disruption of calcium homeostasis. J Biol Chem 278(31):28831-9	|CCH1 |CUP5 |ERG3 |ERG6 |MID1 |PDR5 |PMC1 |PMR1 |PTC1 |RCY1 |SSC1 |VCX1 |VPS45 |YPK1 |MORE
Mutants/Phenotypes Strains/Constructs	Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20	|BNA2 |BSD2 |BUD30 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |FEN1 |FIG2 |GAS1 |GET2 |MRPL17 |MORE
Mutants/Phenotypes Strains/Constructs	Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44	|ANP1 |BUD30 |CTK1 |CTK3 |DAL81 |DST1 |ERG3 |ERG4 |ERG5 |ERG6 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jia N, et al. (2002) Candida albicans sterol C-14 reductase, encoded by the ERG24 gene, as a potential antifungal target site. Antimicrob Agents Chemother 46(4):947-57
Function/Process Mutants/Phenotypes Strains/Constructs	Xu R, et al. (2002) Production of meiosis-activating sterols from metabolically engineered yeast. J Am Chem Soc 124(6):918-9	|ERG25 |HEM1
Protein Sequence Features	Romano JD and Michaelis S (2001) Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol Biol Cell 12(7):1957-71	|CHO2 |ERG4 |OPI3 |STE14
Regulation of	Ren B, et al. (2000) Genome-wide location and function of DNA binding proteins. Science 290(5500):2306-9	|AFI1 |AGA1 |CHS1 |CIK1 |FAR1 |FIG1 |FIG2 |FUR4 |FUS1 |FUS3 |GAL1 |GAL10 |GAL2 |GAL3 |MORE
Cross-species Expression Non-Fungal Related Genes/Proteins	Schrick K, et al. (2000) FACKEL is a sterol C-14 reductase required for organized cell division and expansion in Arabidopsis embryogenesis. Genes Dev 14(12):1471-84	|ERG4
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Mutants/Phenotypes Strains/Constructs	Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22	|ERG3 |ERG7 |ERG9 |HAP1 |HAP2 |HAP3 |HAP4 |HAP5 |HMG1 |HMG2 |INO2 |INO4 |YAP1
Mutants/Phenotypes Other Features Strains/Constructs	Crowley JH, et al. (1998) A calcium-dependent ergosterol mutant of Saccharomyces cerevisiae. Curr Genet 34(2):93-9
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Non-Fungal Related Genes/Proteins	Silve S, et al. (1998) Human lamin B receptor exhibits sterol C14-reductase activity in Saccharomyces cerevisiae. Biochim Biophys Acta 1392(2-3):233-44	|ERG4
Mapping Mutants/Phenotypes	Crowley JH, et al. (1996) Aerobic isolation of an ERG24 null mutant of Saccharomyces cerevisiae. J Bacteriol 178(10):2991-3	|MET2
Function/Process Protein Physical Properties	Barrett-Bee K and Dixon G (1995) Ergosterol biosynthesis inhibition: a target for antifungal agents. Acta Biochim Pol 42(4):465-79	|ERG1 |ERG11 |ERG2 |ERG3
Fungal Related Genes/Proteins Reviews	Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6	|ERG1 |ERG11 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 |FEN1 |FEN2
Reviews	Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116	|ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG25 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |MORE
Reviews	Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30	|ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |ERG9 |HMG1 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Smith S (1995) Cloning and sequence analysis of an ERG24 homolog from Schizosaccharomyces pombe. Gene 155(1):139-40	|ERG4
Alias DNA/RNA Sequence Features Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Regulation of	Lai MH, et al. (1994) The identification of a gene family in the Saccharomyces cerevisiae ergosterol biosynthesis pathway. Gene 140(1):41-9	|ERG2 |ERG4
Mutants/Phenotypes	Bard M, et al. (1993) Sterol synthesis and viability of erg11 (cytochrome P450 lanosterol demethylase) mutations in Saccharomyces cerevisiae and Candida albicans. Lipids 28(11):963-7	|ERG11 |ERG2 |ERG3
DNA/RNA Sequence Features Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Lorenz RT and Parks LW (1992) Cloning, sequencing, and disruption of the gene encoding sterol C-14 reductase in Saccharomyces cerevisiae. DNA Cell Biol 11(9):685-92	|FEN1 |FEN2
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Steel CC (1991) Radio-detection high-performance liquid chromatographic enzyme assay for inhibitors of fungal sterol delta 14-reductase. J Chromatogr 566(2):435-43
Non-Fungal Related Genes/Proteins	Georgatos SD, et al. (1989) Lamin A, lamin B, and lamin B receptor analogues in yeast. J Cell Biol 108(6):2069-82
Function/Process Substrates/Ligands/Cofactors	Aoyama Y and Yoshida Y (1986) Evidence for the contribution of a sterol 14-reductase to the 14 alpha-demethylation of lanosterol by yeast. Biochem Biophys Res Commun 134(2):659-63
Function/Process Protein Physical Properties Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Bottema CK and Parks LW (1978) Delta14-sterol reductase in Saccharomyces cerevisiae. Biochim Biophys Acta 531(3):301-7
Regulation of	Parks LW, et al. (1978) Sterols in yeast subcellular fractions. Lipids 13(10):730-5	|ERG4 |ERG6
Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors	Hays PR, et al. (1977) Accumulation of ergosta-8,14-dien-3beta-ol by Saccharomyces cerevisiae cultured with an azasterol antimycotic agent. Lipids 12(8):666-8

Return to SGD

Send a Message to the SGD Curators