PRM1/YNL279W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIV: 110917 to 112902
CDS: 110917 - 112902

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM1 YNL279W ORF, Verified S000005223

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-08-01. Gene name expires on 2001-08-01.
Description
Pheromone-regulated multispanning membrane protein involved in membrane fusion during mating; predicted to have 5 transmembrane segments and a coiled coil domain; localizes to the shmoo tip; regulated by Ste12p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
conjugation GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0184
Assigned on 2008-05-21 UniProtKB
plasma membrane fusion during cytogamy Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       IEP : Inferred from Expression Pattern
IMP : Inferred from Mutant Phenotype
Assigned on 2006-09-11 SGD
Jin H, et al. (2004) Prm1 prevents contact-dependent lysis of yeast mating pairs. Eukaryot Cell 3(6):1664-73
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-09-11 SGD
response to pheromone Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2006-10-18 SGD
sexual reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
mating projection tip Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       IDA : Inferred from Direct Assay
Assigned on 2001-01-18 SGD
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2008-05-21 UniProtKB
plasma membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-1003
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM1/YNL279W for PRM1
1) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

2) White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM1/YNL279W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM1/YNL279W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSGFKCY

C-term LRKATFD

Length(aa) 661

MW(Da) 73,352

pI 6.16

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.006

Codon Adaptation Index 0.103

Frequency of Optimal Codons 0.421

Hydropathicity of Protein 0.130

Aromaticity Score 0.076

10 20 30 40 50 | | | | | MSGFKCYLQLGDRLSQIWLNKYTLVLLLAMLKLLFFSKSIQHAIEVSETY ILSNCYSIDSLYSKMTDNTPHYLGIMGNYLIEKGMEETVKATLETLSLIV YASEGLVNFAIDLYLGTYACLIVSAVDGTVDVATNITEKLISLVNDTVSS VANELDTGLNDISKIINKVIKAASKVENFFTGDDDDSNMTSSIKSVNLTI SALHNLYIPSSINDKLEELSAKTPDFAQVKNTTKNLISVPFNEVRKNIKA VNASNIIGDTSVLYVPPVSLDNSTGICSSNQSEILAFYSILGHVLKIATV VCITVLICFAVGAMAPVAWNEIKLWRRLCGMRDHYMLSRQDSYTSFSSEN THELKDPFRDPPIQNGQYDVIASYQQCFQTWNTRIAGWMTNLVTFGKSPE NIDPKTKQKIEWVVAYMTSERALCVLGIGLLGILVCICQFVMIALLKHKI SHSLTSNDGDGVQNLLKSSTAVDIENQMSLWSVQTNKYINTTETNINQEV FGWINTTTLSVNNTVATMISDIDTTLADVFNGTLLYNPMKTVVGCAIENK LYTIEKAMTWIHDKAQLHIPRINGTQIKQALAKQTDNSTIPTASSTSAAT ENLLENLVNDMREGLLKILRAYHRITLGELTVALVILAVWLVQLPIALVI LRLRLRKATFD*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM1/YNL279W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM1 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Standard Name	Date Standardized	Reference
PRM1	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YNL279W SGD Systematic Sequence

855442 NCBI: Gene ID

NP_014120.1 NCBI: RefSeq protein version ID

NP_014120.1 NCBI: RefSeq protein version ID

6324050 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YNL279W	SGD Systematic Sequence
855442	NCBI: Gene ID
NP_014120.1	NCBI: RefSeq protein version ID
NP_014120.1	NCBI: RefSeq protein version ID
6324050	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
24 curated references; 0 references not yet curated
Cellular Location
Mutants/Phenotypes
Protein Physical Properties
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Olmo VN and Grote E (2010) Prm1 functions as a disulfide-linked complex in yeast mating. J Biol Chem 285(4):2274-83
       |FUS1 |FUS2 |IST2
Fungal Related Genes/Proteins
Fleissner A, et al. (2009) The Saccharomyces cerevisiae PRM1 Homolog in Neurospora crassa Is Involved in Vegetative and Sexual Cell Fusion Events but Also Has Postfertilization Functions. Genetics 181(2):497-510

Regulation of
Transcription
Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
       |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Reviews
Engel A and Walter P (2008) Membrane lysis during biological membrane fusion: collateral damage by misregulated fusion machines. J Cell Biol 183(2):181-6
       |FIG1 |VAM7 |YPT7
Genetic Interactions
Mutants/Phenotypes
Jin H, et al. (2008) Ergosterol promotes pheromone signaling and plasma membrane fusion in mating yeast. J Cell Biol 180(4):813-26
       |ERG2 |ERG3 |ERG6 |LCB1 |STE5
Reviews
Ydenberg CA and Rose MD (2008) Yeast mating: a model system for studying cell and nuclear fusion. Methods Mol Biol 475:3-20
       |AGA1 |ASG7 |BEM1 |BIK1 |BIM1 |BNI1 |CDC24 |CDC42 |CHS3 |CHS5 |CIK1 |FAR1 |FIG1 |FIG2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Aguilar PS, et al. (2007) The Plasma Membrane Proteins Prm1 and Fig1 Ascertain Fidelity of Membrane Fusion during Yeast Mating. Mol Biol Cell 18(2):547-56
       |FIG1 |TCB1 |TCB2 |TCB3
Reviews
Chen EH, et al. (2007) Cell-cell fusion. FEBS Lett 581(11):2181-93
       |AGA1 |AGA2 |ASG7 |BIK1 |CDC42 |CDC48 |FAR1 |FIG1 |FUS1 |FUS2 |FUS3 |GPA1 |KAR2 |KAR3 |MORE
Reviews
Chen RE and Thorner J (2007) Function and regulation in MAPK signaling pathways: lessons learned from the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1773(8):1311-40
       |AMA1 |BCK1 |BEM1 |CAF20 |CAK1 |CDC24 |CDC42 |CLN1 |CLN2 |CLN3 |DHH1 |DIG1 |DIG2 |EFT1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Heiman MG, et al. (2007) The Golgi-resident protease Kex2 acts in conjunction with Prm1 to facilitate cell fusion during yeast mating. J Cell Biol 176(2):209-22
       |KEX1 |KEX2 |STE13
DNA/RNA Sequence Features
Regulation of
Chou S, et al. (2006) Regulation of mating and filamentation genes by two distinct Ste12 complexes in Saccharomyces cerevisiae. Mol Cell Biol 26(13):4794-805
       |AFR1 |AGA1 |ASG7 |BAR1 |CHS7 |CIK1 |CLN1 |CWP1 |DDR48 |DIG1 |DIG2 |FIG1 |FUS1 |FUS2 |MORE
Mutants/Phenotypes
Strains/Constructs
Nolan S, et al. (2006) FUS1 regulates the opening and expansion of fusion pores between mating yeast. Mol Biol Cell 17(5):2439-50
       |FUS1 |FUS2 |RVS161 |SPA2
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Zhang NN, et al. (2006) Multiple signaling pathways regulate yeast cell death during the response to mating pheromones. Mol Biol Cell 17(8):3409-22
       |ATP2 |BAR1 |BCK1 |BNI1 |CNB1 |COQ1 |COX6 |CPR3 |CYC3 |DNM1 |FAR1 |FIG1 |FIS1 |FUS1 |MORE
DNA/RNA Sequence Features
Regulation of
Transcription
Vyas VK, et al. (2005) Repressors Nrg1 and Nrg2 regulate a set of stress-responsive genes in Saccharomyces cerevisiae. Eukaryot Cell 4(11):1882-91
       |ADK2 |AGA2 |AGP2 |AIM13 |AIM19 |AIM34 |AIM36 |ALD4 |ASG7 |ATP15 |ATP16 |ATP17 |ATP18 |ATP2 |MORE
DNA/RNA Sequence Features
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
van Bakel H, et al. (2005) Gene expression profiling and phenotype analyses of S. cerevisiae in response to changing copper reveals six genes with new roles in copper and iron metabolism. Physiol Genomics 22(3):356-67
           |AFT1 |AFT2 |AGA1 |AGA2 |AKR1 |ALD3 |ALD5 |AMS1 |APE2 |AQY2 |ARG1 |ARN1 |ARN2 |ATP7 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Jin H, et al. (2004) Prm1 prevents contact-dependent lysis of yeast mating pairs. Eukaryot Cell 3(6):1664-73
       |FPS1 |FUS1 |FUS2
RNA Levels and Processing
Regulation of
Ohkuni K, et al. (2003) Genome-wide expression analysis of NAP1 in Saccharomyces cerevisiae. Biochem Biophys Res Commun 306(1):5-9
       |CLN1 |CMR1 |DIG2 |GLC3 |GSY1 |NAP1 |PCL1 |PRM2 |SEO1 |SLI15 |SNZ2 |THI72 |TMA10 |TOS2 |MORE
Regulation of
Zeitlinger J, et al. (2003) Program-specific distribution of a transcription factor dependent on partner transcription factor and MAPK signaling. Cell 113(3):395-404
             |ACT1 |ADE1 |AFR1 |AGA1 |ASG7 |BEM1 |BEM2 |BMH1 |BUD14 |BUD8 |CHS1 |CHS7 |CIK1 |CLA4 |MORE
Cellular Location
Bagnat M and Simons K (2002) Cell surface polarization during yeast mating. Proc Natl Acad Sci U S A 99(22):14183-8
       |BUL1 |BUL2 |ERG6 |FIG1 |FUS1 |FUS2 |GAP1 |HXT2 |LCB1 |LCB3 |SHO1 |STE6 |TRE1
RNA Levels and Processing
Regulation of
Epstein CB, et al. (2001) Genome-wide responses to mitochondrial dysfunction. Mol Biol Cell 12(2):297-308
         |ACO1 |ACS1 |ADH2 |ADY2 |AGP1 |AGP2 |ALD4 |ALT1 |ATO3 |BAT2 |BIO2 |CAR1 |CDA1 |CIT1 |MORE
RNA Levels and Processing
Regulation of
Harris K, et al. (2001) Role of scaffolds in MAP kinase pathway specificity revealed by custom design of pathway-dedicated signaling proteins. Curr Biol 11(23):1815-24
             |AFR1 |AGA1 |ARI1 |ASG7 |CIK1 |CRG1 |CWP1 |DAK1 |DSF1 |FUS1 |FUS2 |GPD1 |GRE2 |HYM1 |MORE
Reviews
White JM and Rose MD (2001) Yeast mating: getting close to membrane merger. Curr Biol 11(1):R16-20
       |PRM2 |PRM3 |PRM4 |PRM6 |VAM3 |VAM7
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Regulation of
Strains/Constructs
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM10 |PRM2 |PRM3 |PRM4 |PRM5 |PRM6 |PRM7 |PRM8 |PRM9
Protein Sequence Features
Protein-protein Interactions
Robinson KA, et al. (2000) A network of yeast basic helix-loop-helix interactions. Nucleic Acids Res 28(22):4460-6
       |APL2 |BCK2 |CHO1 |HCS1 |INO2 |INO4 |PHO4 |RTG1 |RTG3 |TYE7 |YLR422W |YMR317W |YNR064C

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.