---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

PIK1/YNL267W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 140879 to 144079 CDS: 140879 - 144079 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
PIK1	YNL267W	PIK41, PIK120	ORF, Verified	S000005211
Description
Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokineses through the actin cytoskeleton

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By 1-phosphatidylinositol 4-kinase activity Flanagan CA, et al. (1993) Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability. Science 262(5138):1444-8      IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Garcia-Bustos JF, et al. (1994) PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus. EMBO J 13(10):2352-61      IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5        IMP : Inferred from Mutant Phenotype Assigned on 2008-06-09 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.7.1.67 Assigned on 2007-05-23 UniProtKB ATP binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2009-05-05 UniProtKB binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016024 Assigned on 2008-02-13 UniProtKB inositol or phosphatidylinositol kinase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001263 , EBI:IPR015433 Assigned on 2008-02-13 UniProtKB kinase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0418 Assigned on 2007-05-23 UniProtKB nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2009-05-05 UniProtKB phosphotransferase activity, alcohol group as acceptor DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000403 , EBI:IPR018936 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By phosphoinositide phosphorylation Flanagan CA, et al. (1993) Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability. Science 262(5138):1444-8      IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Garcia-Bustos JF, et al. (1994) PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus. EMBO J 13(10):2352-61      IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5        IMP : Inferred from Mutant Phenotype Assigned on 2008-06-09 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR015433 Assigned on 2008-02-13 UniProtKB phosphoinositide-mediated signaling DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR015433 Assigned on 2008-02-13 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By nucleus Garcia-Bustos JF, et al. (1994) PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus. EMBO J 13(10):2352-61      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5        IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Strahl T, et al. (2005) Yeast phosphatidylinositol 4-kinase, Pik1, has essential roles at the Golgi and in the nucleus. J Cell Biol 171(6):967-79        IDA : Inferred from Direct Assay Assigned on 2006-02-01 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0191 Assigned on 2008-02-13 UniProtKB trans-Golgi network Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5        IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD Strahl T, et al. (2005) Yeast phosphatidylinositol 4-kinase, Pik1, has essential roles at the Golgi and in the nucleus. J Cell Biol 171(6):967-79        IDA : Inferred from Direct Assay Assigned on 2008-06-09 SGD

Pathways [TOP] [NEXT]
phosphatidylinositol phosphate biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for PIK1/YNL267W for PIK1 Phosphatidylinositol 4-kinases (ATP:phosphatidylinositol-4-phosphotransferase, EC 2.7.1.67) are evolutionarily conserved enzymes that catalyze the formation of phosphatidylinositol 4-phosphate and ADP from phosphatidylinositol (PtdIns or PI) and ATP, the first step in the synthesis of phosphatidylinositol phosphates (1, 2). Two types of PtdIns 4-kinases (types II and III) have been identified based on their biochemical properties (1). Type III PtdIns 4-kinases all contain a common catalytic kinase domain, which is also found in type I PtdIns 3-kinases (3, 4). There are two type III PtdIns 4-kinases in S. cerevisiae, encoded by PIK1 and STT4 (5, 6). LSB6 encodes the single type II PtdIns 4-kinase in yeast (1, 2). Pik1p is a soluble 125-kDa enzyme (7), and Stt4p is a plasma membrane-associated 215-kDa enzyme (6, 8). Together, Pik1p and Stt4p account for the vast majority of PtdIns 4-kinase activity in wild-type yeast cells (9). The two different type III PtdIns 4-kinases synthesize discrete pools of PtdIns 4-phosphate with essential roles in cell physiology (9). Overproduction of one of these type III PtdIns 4-kinases cannot compensate for a gene disruption in the other (9). Stt4p is homologous to mammalian PtdIns 4-kinase alpha, and Pik1p to mammalian PtdIns 4-kinase beta (3). Pik1p localizes to the nucleus and to the Golgi, where it regulates secretion (10, 9, 11, 12, 13, 14). Pik1p is also required for proper Golgi and vacuole membrane dynamics, and endocytosis (11, 9, 2). Pik1p is activated by frequenin (Frq1p), which binds Pik1p at its amino terminus, and aids in targeting Pik1p to the Golgi (15, 16, 13, 17). Pik1p also binds the 14-3-3 phosphorylation-dependent protein chaperones Bmh1p and Bmh2p (18). This interaction occurs primarily in the cytoplasm, and controls the nucleocytoplasmic shuttling and availability of Pik1p for Golgi recruitment (18). Nutrient deprivation results in a relocation of Pik1p from the Golgi to the nucleus, which is rapidly reversed upon restoration of nutrient supply (18). pik1 null mutants are inviable, and conditional pik1 mutants exhibit defects in cytokinesis, endocytosis, protein secretion, and vacuolar dynamics (10, 5, 9, 2). Temperature-sensitive pik1 mutants also display aberrant Golgi morphology (9), and can fail to undergo meiosis and spore formation (19). Inactivation of Pik1p results in severe translation initiation defects and a marked increased in the phosphorylation of translation initiation factor eIF2alpha (20). Overexpression of PIK1 produces defects in membrane trafficking (21). About Phosphatidylinositol Phosphate Biosynthesis The phosphorylated products of phosphatidylinositol (PtdIns, PI), collectively referred to as phosphoinositides or phosphatidylinositol phosphates (PtdInsPs, PIPs), are membrane-bound lipids that function as structural components of membranes, as well as regulators of many cellular processes in eukaryotes, including vesicle-mediated membrane trafficking, cell wall integrity, and actin cytoskeleton organization (reviewed in 22 and 23). PtdInsPs are also precursors of the water-soluble inositol phosphates (IPs), an important class of intracellular signaling molecules (reviewed in 24, 25 and 26). The inositol ring of the membrane phospholipids and the water-soluble IPs are readily phosphorylated and dephosphorylated at a number of positions making them well suited as key regulators. PtdIns can be phosphorylated at one or a combination of positions (3', 4', or 5') on the inositol headgroup, generating a set of unique stereoisomers that have specific biological functions (reviewed in 22). These stereoisomers have been shown to be restricted to certain membranes (reviewed in 22). Phosphatidylinositol 4-phosphate (PtdIns4P) is the major PtdInsP species of the Golgi apparatus, where it plays a role in the vesicular trafficking of secretory proteins from the Golgi to the plasma membrane (reviewed in 22). Phosphatidylinositol 4,5-bisphosphate (PtdIns[4,5]P2) is the major species found at the plasma membrane and is involved in the regulation of actin cytoskeleton organization, as well as cell wall integrity, and heat shock response pathways (reviewed in 22). Phosphatidylinositol 3-phosphate (PtdIns3P) is found predominantly at endosomal membranes and in multivesicular bodies (MVB), where it plays a role in endosomal and vacuolar membrane trafficking. Phosphatidylinositol 3,5-bisphosphate (PtdIns[3,5]P2) is found on vacuolar membranes where it plays an important role in the MVB sorting pathway (reviewed in 22). Phosphorylation and dephosphorylation of the inositol headgroups of PtdInsPs at specific membrane locations signals the recruitment of certain proteins essential for vesicular transport (23, and reviewed in 22). PtdInsPs recruit proteins that contain PtdInsP-specific binding domains, such as the well-studied pleckstrin homology (PH) domain that recognizes the phosphorylation pattern of specific PtdInsP inositol headgroups (reviewed in 22). A number of kinases and phosphatases are involved in the generation and interconversions of PtdInsPs, the majority of which have been well conserved during evolution (reviewed in 22). The PtdInsP kinases, in contrast to the lipid phosphatases, have a higher degree of specificity. While each kinase appears to phosphorylate only one substrate, many of the lipid phosphatases can dephosphorylate a number of substrates. Last Updated: 2008-06-09

Basic References [TOP]

BASIC INFORMATION REFERENCES forPIK1/YNL267W for PIK1 1) Han GS, et al. (2002) The Saccharomyces cerevisiae LSB6 gene encodes phosphatidylinositol 4-kinase activity. J Biol Chem 277(49):47709-18        2) Shelton SN, et al. (2003) Saccharomyces cerevisiae contains a Type II phosphoinositide 4-kinase. Biochem J 371(Pt 2):533-40        3) Fruman DA, et al. (1998) Phosphoinositide kinases. Annu Rev Biochem 67:481-507            4) Odorizzi G, et al. (2000) Phosphoinositide signaling and the regulation of membrane trafficking in yeast. Trends Biochem Sci 25(5):229-35        5) Flanagan CA, et al. (1993) Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability. Science 262(5138):1444-8      6) Yoshida S, et al. (1994) A novel gene, STT4, encodes a phosphatidylinositol 4-kinase in the PKC1 protein kinase pathway of Saccharomyces cerevisiae. J Biol Chem 269(2):1166-72        7) Flanagan CA and Thorner J (1992) Purification and characterization of a soluble phosphatidylinositol 4-kinase from the yeast Saccharomyces cerevisiae. J Biol Chem 267(33):24117-25        8) Audhya A and Emr SD (2002) Stt4 PI 4-kinase localizes to the plasma membrane and functions in the Pkc1-mediated MAP kinase cascade. Dev Cell 2(5):593-605        9) Audhya A, et al. (2000) Distinct roles for the yeast phosphatidylinositol 4-kinases, Stt4p and Pik1p, in secretion, cell growth, and organelle membrane dynamics. Mol Biol Cell 11(8):2673-89        10) Garcia-Bustos JF, et al. (1994) PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus. EMBO J 13(10):2352-61      11) Hama H, et al. (1999) Direct involvement of phosphatidylinositol 4-phosphate in secretion in the yeast Saccharomyces cerevisiae. J Biol Chem 274(48):34294-300        12) Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5        13) Strahl T, et al. (2005) Yeast phosphatidylinositol 4-kinase, Pik1, has essential roles at the Golgi and in the nucleus. J Cell Biol 171(6):967-79        14) Sciorra VA, et al. (2005) Synthetic genetic array analysis of the PtdIns 4-kinase Pik1p identifies components in a Golgi-specific Ypt31/rab-GTPase signaling pathway. Mol Biol Cell 16(2):776-93          15) Hendricks KB, et al. (1999) Yeast homologue of neuronal frequenin is a regulator of phosphatidylinositol-4-OH kinase. Nat Cell Biol 1(4):234-41        16) Huttner IG, et al. (2003) Molecular interactions of yeast frequenin (Frq1) with the phosphatidylinositol 4-kinase isoform, Pik1. J Biol Chem 278(7):4862-74        17) Strahl T, et al. (2007) Structural insights into activation of phosphatidylinositol 4-kinase (pik1) by yeast frequenin (Frq1). J Biol Chem 282(42):30949-59      18) Demmel L, et al. (2008) Nucleocytoplasmic shuttling of the Golgi phosphatidylinositol 4-kinase pik1 is regulated by 14-3-3 proteins and coordinates Golgi function with cell growth. Mol Biol Cell 19(3):1046-61        19) Rudge SA, et al. (2004) Roles of phosphoinositides and of Spo14p (phospholipase D)-generated phosphatidic acid during yeast sporulation. Mol Biol Cell 15(1):207-18        20) Cameroni E, et al. (2006) Phosphatidylinositol 4-Phosphate Is Required for Translation Initiation in Saccharomyces cerevisiae. J Biol Chem 281(50):38139-49        21) Schorr M, et al. (2001) The phosphoinositide phosphatase Sac1p controls trafficking of the yeast Chs3p chitin synthase. Curr Biol 11(18):1421-6        22) Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404        23) De Camilli P, et al. (1996) Phosphoinositides as regulators in membrane traffic. Science 271(5255):1533-9      24) York JD (2006) Regulation of nuclear processes by inositol polyphosphates. Biochim Biophys Acta 1761(5-6):552-9        25) Bennett M, et al. (2006) Inositol pyrophosphates: metabolism and signaling. Cell Mol Life Sci 63(5):552-64          26) Bhandari R, et al. (2007) Inositol pyrophosphate pyrotechnics. Cell Metab 5(5):321-3

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PIK1/YNL267W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PIK1/YNL267W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MHKASSS C-term ITQGIYS Length(aa) 1,066 MW(Da) 119,922 pI 6.46 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.071   Codon Adaptation Index 0.149   Frequency of Optimal Codons 0.446   Hydropathicity of Protein -0.527   Aromaticity Score 0.071

10 20 30 40 50 | | | | | MHKASSSKKSFDDTIELKKNEQLLKLINSSEFTLHNCVELLCKHSENIGI HYYLCQKLATFPHSELQFYIPQLVQVLVTMETESMALEDLLLRLRAENPH FALLTFWQLQALLTDLSTDPASYGFQVARRVLNNLQTNLFNTSSGSDKNV KIHENVAPALVLSSMIMSAIAFPQLSEVTKPLVESQGRRQKAFVFKLARS AMKDFTKNMTLKNTLLNKKTSRSKRVSSNRSSTPTSPIDLIDPIKTKEDA SFRKSRHSEVKLDFDIVDDIGNQVFEERISSSIKLPKRKPKYLDNSYVHR TYDGKNINRDGSISNTAKALDGNKGDYISPKGRNDENNEIGNNEDETGGE TEEDADALNSDHFTSSMPDLHNIQPRTSSASSASLEGTPKLNRTNSQPLS RQAFKNSKKANSSLSQEIDLSQLSTTSKIKMLKANYFRCETQFAIALETI SQRLARVPTEARLSALRAELFLLNRDLPAEVDIPTLLPPNKKGKLHKLVT ITANEAQVLNSAEKVPYLLLIEYLRDEFDFDPTSETNERLLKKISGNQGG LIFDLNYMNRKENNENRNESTLTSNNTRSSVYDSNSFNNGASRNEGLSST SRSDSASTAHVRTEVNKEEDLGDMSMVKVRNRTDDEAYRNALVIQSAANV PILPDDSQDRSPELNFGSNLDEVLIENGINSKNIHSQTDALADQMRVSAV MLAQLDKSPQQLSESTKQIRAQIISSMKEVQDKFGYHDLEALHGMAGERK LENDLMTGGIDTSYLGEDWATKKERIRKTSEYGHFENWDLCSVIAKTGDD LRQEAFAYQMIQAMANIWVKEKVDVWVKRMKILITSANTGLVETITNAMS VHSIKKALTKKMIEDAELDDKGGIASLNDHFLRAFGNPNGFKYRRAQDNF ASSLAAYSVICYLLQVKDRHNGNIMIDNEGHVSHIDFGFMLSNSPGSVGF EAAPFKLTYEYIELLGGVEGEAFKKFVELTKSSFKALRKYADQIVSMCEI MQKDNMQPCFDAGEQTSVQLRQRFQLDLSEKEVDDFVENFLIGKSLGSIY TRIYDQFQLITQGIYS*

Protein Structures from PDB: proteins of known structure with sequence similarity to PIK1/YNL267W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to PIK1 Homolog Source (per PDB) Protein Alignment: PIK1 vs. Homolog External Links P-Value %Identical %Similar Alignment 3ihy ( Chain: C, D, E, A, B) Phosphatidylinositol 3- PDB_Info PDB_Structure Unknown Chain C = 6.6e-23 25 34 View alignment SCOP MMDB CATH Chain D = 6.6e-23 25 34 View alignment Chain E = 6.6e-23 25 34 View alignment Chain A = 6.6e-23 25 34 View alignment Chain B = 6.6e-23 25 34 View alignment 2rd0 ( Chain: A) Structure of a human p110alpha/p85alpha complex PDB_Info PDB_Structure Homo sapiens 3.2e-18 24 33 View alignment SCOP MMDB CATH 3hiz ( Chain: A) Phosphatidylinositol-4 PDB_Info PDB_Structure Unknown 3.2e-18 24 33 View alignment SCOP MMDB CATH 3hhm ( Chain: A) Phosphatidylinositol-4 PDB_Info PDB_Structure Unknown 3.2e-18 24 33 View alignment SCOP MMDB CATH 3dbs ( Chain: A) Structure of pi3k gamma in complex with gdc0941 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 3dpd ( Chain: A) Achieving multi-isoform pi3k inhibition in a series of substituted 3,4-dihydro-2h-benzo[1,4]oxazines PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 2v4l ( Chain: A) Complex of human phosphoinositide 3-kinase catalytic subunit gamma (p110 gamma) with pik-284 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 1e8z ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 3ibe ( Chain: A) Phosphatidylinositol-4, PDB_Info PDB_Structure Unknown 1.3e-15 24 33 View alignment SCOP MMDB CATH 2chx ( Chain: A) A pharmacological map of the pi3-k family defines a role for p110alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-90 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 3ene ( Chain: A) Complex of pi3k gamma with an inhibitor PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 1he8 ( Chain: A) Ras g12v - pi 3-kinase gamma complex PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 2a5u ( Chain: A) Crystal structure of human pi3kgamma complexed with as605240 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 2chw ( Chain: A) A pharmacological map of the pi3-k family defines a role for p110 alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-39 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 2chz ( Chain: A) A pharmacological map of the pi3-k family defines a role for p110alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-93 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 3csf ( Chain: A) Crystal structure of pi3k p110gamma catalytical domain in complex with organoruthenium inhibitor dw2 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 2a4z ( Chain: A) Crystal structure of human pi3kgamma complexed with as604850 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 1e8y ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 3cst ( Chain: A) Crystal structure of pi3k p110gamma catalytical domain in complex with organoruthenium inhibitor e5e2 PDB_Info PDB_Structure Homo sapiens 1.3e-15 24 33 View alignment SCOP MMDB CATH 1e7u ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Sus scrofa 1.7e-15 24 33 View alignment SCOP MMDB CATH 1e8w ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Sus scrofa 1.7e-15 24 33 View alignment SCOP MMDB CATH 1e90 ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Sus scrofa 1.7e-15 24 33 View alignment SCOP MMDB CATH 1e8x ( Chain: A) Structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling PDB_Info PDB_Structure Sus scrofa 1.7e-15 24 33 View alignment SCOP MMDB CATH 1e7v ( Chain: A) Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine PDB_Info PDB_Structure Sus scrofa 1.7e-15 24 33 View alignment SCOP MMDB CATH 2ju0 ( Chain: B) Structure of yeast frequenin bound to pdtins 4-kinase PDB_Info PDB_Structure Saccharomyces cerevisiae 6.4e-15 100 0 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
PIK1	Flanagan CA, et al. (1993) Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability. Science 262(5138):1444-8

Alias Name(s)	Reference
PIK41	Hunter T and Plowman GD (1997) The protein kinases of budding yeast: six score and more. Trends Biochem Sci 22(1):18-22
PIK120	Hunter T and Plowman GD (1997) The protein kinases of budding yeast: six score and more. Trends Biochem Sci 22(1):18-22

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNL267W	SGD Systematic Sequence
855454	NCBI: Gene ID
NP_014132.1	NCBI: RefSeq protein version ID
NP_014132.1	NCBI: RefSeq protein version ID
6324062	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
67 curated references; 0 references not yet curated
Reviews	Manjithaya R, et al. (2010) Molecular mechanism and physiological role of pexophagy. FEBS Lett	|AMS1 |ATG1 |ATG10 |ATG11 |ATG12 |ATG13 |ATG14 |ATG15 |ATG16 |ATG17 |ATG18 |ATG19 |ATG2 |ATG20 |MORE
Reviews	Mendonsa R and Engebrecht J (2009) Phospholipase D function in Saccharomyces cerevisiae. Biochim Biophys Acta 1791(9):970-4	|CSR1 |DGK1 |MSS4 |PAH1 |PDR16 |PDR17 |SEC14 |SFH5 |SMA1 |SNC1 |SPO14 |SPO20 |SSO1 |STE20 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Natarajan P, et al. (2009) Regulation of a Golgi flippase by phosphoinositides and an ArfGEF. Nat Cell Biol 11(12):1421-6	|DRS2 |GEA2
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Park JS, et al. (2009) Essential role for Schizosaccharomyces pombe pik1 in septation. PLoS One 4(7):e6179
Mutants/Phenotypes Regulatory Role Strains/Constructs	Wood CS, et al. (2009) PtdIns4P recognition by Vps74/GOLPH3 links PtdIns 4-kinase signaling to retrograde Golgi trafficking. J Cell Biol 187(7):967-75	|FRQ1 |KRE2 |SAC1 |VPS74
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Strains/Constructs Techniques and Reagents	Demmel L, et al. (2008) Nucleocytoplasmic shuttling of the Golgi phosphatidylinositol 4-kinase pik1 is regulated by 14-3-3 proteins and coordinates Golgi function with cell growth. Mol Biol Cell 19(3):1046-61	|BMH1 |BMH2 |FRQ1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Knodler A, et al. (2008) Expression of yeast lipid phosphatase Sac1p is regulated by phosphatidylinositol-4-phosphate. BMC Mol Biol 9:16	|OPI1 |SAC1 |STT4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Mousley CJ, et al. (2008) Trans-Golgi network and endosome dynamics connect ceramide homeostasis with regulation of the unfolded protein response and TOR signaling in yeast. Mol Biol Cell 19(11):4785-803	|CKI1 |GSG1 |ISC1 |KES1 |PPN1 |SEC14 |SNC1 |SNC2 |STT4 |SUI2 |TLG2 |YPC1
Mutants/Phenotypes	Prouzet-Mauleon V, et al. (2008) Phosphoinositides Affect both the Cellular Distribution and Activity of the F-BAR-containing RhoGAP Rgd1p in Yeast. J Biol Chem 283(48):33249-57	|RGD1 |RHO3 |RHO4 |STT4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fairn GD, et al. (2007) The oxysterol binding protein Kes1p regulates Golgi apparatus phosphatidylinositol-4-phosphate function. Proc Natl Acad Sci U S A 104(39):15352-7	|CKI1 |FRQ1 |GSG1 |KES1 |KRE11 |OSH2 |SEC14 |TRS33 |YPT31 |YPT32
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Faulhammer F, et al. (2007) Growth control of Golgi phosphoinositides by reciprocal localization of sac1 lipid phosphatase and pik1 4-kinase. Traffic 8(11):1554-67	|DPM1 |FRQ1 |RER1 |SAC1 |SEC12 |SEC21 |SEC62
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Howe AG, et al. (2007) Regulation of Phosphoinositide Levels by the Phospholipid Transfer Protein Sec14p Controls Cdc42p/p21-Activated Kinase-Mediated Cell Cycle Progression at Cytokinesis. Eukaryot Cell 6(10):1814-23	|ACT1 |ARK1 |CDC12 |CDC42 |CDC43 |CLA4 |CLB5 |GLC8 |KES1 |MSS4 |SAC1 |SEC14 |SEO1 |STE20 |MORE
Protein Processing/Modification/Regulation Regulation of	Mandal AK, et al. (2007) Cdc37 has distinct roles in protein kinase quality control that protect nascent chains from degradation and promote posttranslational maturation. J Cell Biol 176(3):319-28	|BCK1 |CDC37 |FUS3 |GUK1 |PGK1 |PRS5 |SKY1 |SLT2 |STE11 |TPK2 |VPS34
Reviews	Strahl T and Thorner J (2007) Synthesis and function of membrane phosphoinositides in budding yeast, Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):353-404	|FAB1 |FIG4 |INP51 |INP52 |INP53 |INP54 |LSB6 |MSS4 |PLC1 |SAC1 |STT4 |VPS34 |YMR1
Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Strahl T, et al. (2007) Structural insights into activation of phosphatidylinositol 4-kinase (pik1) by yeast frequenin (Frq1). J Biol Chem 282(42):30949-59	|FRQ1
Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation	Cameroni E, et al. (2006) Phosphatidylinositol 4-Phosphate Is Required for Translation Initiation in Saccharomyces cerevisiae. J Biol Chem 281(50):38139-49	|ACT1 |GLN3 |MSS4 |STT4
Mutants/Phenotypes Strains/Constructs	Raychaudhuri S, et al. (2006) Nonvesicular sterol movement from plasma membrane to ER requires oxysterol-binding protein-related proteins and phosphoinositides. J Cell Biol 173(1):107-19	|HES1 |KES1 |MSS4 |OSH2 |OSH3 |OSH6 |OSH7 |PSD1 |PSD2 |SEC18 |STT4 |SWH1 |UPC2
Mutants/Phenotypes Strains/Constructs	Wang CW, et al. (2006) Exomer: A coat complex for transport of select membrane proteins from the trans-Golgi network to the plasma membrane in yeast. J Cell Biol 174(7):973-83	|ARF1 |BCH1 |BCH2 |BUD7 |CHS5 |CHS6 |SEC7
Mutants/Phenotypes Strains/Constructs	Chang FS, et al. (2005) A WASp-binding type II phosphatidylinositol 4-kinase required for actin polymerization-driven endosome motility. J Cell Biol 171(1):133-42	|LAS17 |LSB6 |MSS4 |STT4
Protein Processing/Modification/Regulation	Gruhler A, et al. (2005) Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Mol Cell Proteomics 4(3):310-27	|ADR1 |AFR1 |AHP1 |BEM3 |BOI2 |BUD4 |CDC15 |CDC19 |CDC28 |CHD1 |COG3 |CRP1 |CUE2 |CYR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nguyen PH, et al. (2005) Interaction of Pik1p and Sjl proteins in membrane trafficking. FEMS Yeast Res 5(4-5):363-71	|INP51 |INP52 |INP53
Mutants/Phenotypes Regulation of	Routt SM, et al. (2005) Nonclassical PITPs activate PLD via the Stt4p PtdIns-4-kinase and modulate function of late stages of exocytosis in vegetative yeast. Traffic 6(12):1157-72	|CSR1 |LSB6 |MSS4 |PDR16 |PDR17 |PSD1 |SAC1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sciorra VA, et al. (2005) Synthetic genetic array analysis of the PtdIns 4-kinase Pik1p identifies components in a Golgi-specific Ypt31/rab-GTPase signaling pathway. Mol Biol Cell 16(2):776-93	|CHS3 |DRS2 |GAS1 |HXT1 |KRE11 |MDR1 |PRC1 |SNC1 |TAT2 |TRS130 |TRS33 |YPT31 |YPT32
Cellular Location Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Strahl T, et al. (2005) Yeast phosphatidylinositol 4-kinase, Pik1, has essential roles at the Golgi and in the nucleus. J Cell Biol 171(6):967-79	|FRQ1 |MSN5
Genetic Interactions Strains/Constructs	Tahirovic S, et al. (2005) Regulation of intracellular phosphatidylinositol-4-phosphate by the Sac1 lipid phosphatase. Traffic 6(2):116-30	|LSB6 |PTC1 |SAC1 |SLA2 |SNF7 |STT4 |VPS15 |VPS34
Mutants/Phenotypes Strains/Constructs	Winters MJ, et al. (2005) A membrane binding domain in the ste5 scaffold synergizes with gbetagamma binding to control localization and signaling in pheromone response. Mol Cell 20(1):21-32	|MSS4 |STE11 |STE4 |STE5 |STT4
Genetic Interactions Mutants/Phenotypes	Aronov S and Gerst JE (2004) Involvement of the late secretory pathway in actin regulation and mRNA transport in yeast. J Biol Chem 279(35):36962-71	|ACT1 |ASH1 |CDC42 |RHO3 |SEC1 |SEC10 |SEC15 |SEC4 |SEC9 |SRO7 |SSO1 |YPT31
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Perera NM, et al. (2004) Hypo-osmotic stress activates Plc1p-dependent phosphatidylinositol 4,5-bisphosphate hydrolysis and inositol Hexakisphosphate accumulation in yeast. J Biol Chem 279(7):5216-26	|ARG82 |IPK1 |KCS1 |LSB6 |PLC1 |STT4
Cell Cycle Phase Involved Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Rudge SA, et al. (2004) Roles of phosphoinositides and of Spo14p (phospholipase D)-generated phosphatidic acid during yeast sporulation. Mol Biol Cell 15(1):207-18	|MSS4 |SEC14 |SPO14
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Huttner IG, et al. (2003) Molecular interactions of yeast frequenin (Frq1) with the phosphatidylinositol 4-kinase isoform, Pik1. J Biol Chem 278(7):4862-74	|FRQ1
Fungal Related Genes/Proteins	Shelton SN, et al. (2003) Saccharomyces cerevisiae contains a Type II phosphoinositide 4-kinase. Biochem J 371(Pt 2):533-40	|LSB6 |STT4
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Regulation of Strains/Constructs	Strahl T, et al. (2003) Conservation of regulatory function in calcium-binding proteins: human frequenin (neuronal calcium sensor-1) associates productively with yeast phosphatidylinositol 4-kinase isoform, Pik1. J Biol Chem 278(49):49589-99	|FRQ1
Function/Process Mutants/Phenotypes Strains/Constructs	Wenk MR, et al. (2003) Phosphoinositide profiling in complex lipid mixtures using electrospray ionization mass spectrometry. Nat Biotechnol 21(7):813-7	|SAC1 |VPS34
Function/Process Mutants/Phenotypes Strains/Constructs	Wicky S, et al. (2003) Bsp1p/Ypr171p is an adapter that directly links some synaptojanin family members to the cortical actin cytoskeleton in yeast. FEBS Lett 537(1-3):35-41	|ACT1 |BSP1 |INP52 |INP53 |RVS167
Cellular Location Function/Process Substrates/Ligands/Cofactors	Audhya A and Emr SD (2002) Stt4 PI 4-kinase localizes to the plasma membrane and functions in the Pkc1-mediated MAP kinase cascade. Dev Cell 2(5):593-605	|MSS4 |PKC1 |RHO1 |ROM2 |SFK1 |STT4
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Han GS, et al. (2002) The Saccharomyces cerevisiae LSB6 gene encodes phosphatidylinositol 4-kinase activity. J Biol Chem 277(49):47709-18	|LSB6 |STT4
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Li X, et al. (2002) Analysis of oxysterol binding protein homologue Kes1p function in regulation of Sec14p-dependent protein transport from the yeast Golgi complex. J Cell Biol 157(1):63-77	|GCS1 |KES1 |SAC1 |SEC14 |STT4
Function/Process	Stefan CJ, et al. (2002) The yeast synaptojanin-like proteins control the cellular distribution of phosphatidylinositol (4,5)-bisphosphate. Mol Biol Cell 13(2):542-57	|INP52 |MSS4
Non-Fungal Related Genes/Proteins	Bourne Y, et al. (2001) Immunocytochemical localization and crystal structure of human frequenin (neuronal calcium sensor 1). J Biol Chem 276(15):11949-55	|FRQ1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Foti M, et al. (2001) Sac1 lipid phosphatase and Stt4 phosphatidylinositol 4-kinase regulate a pool of phosphatidylinositol 4-phosphate that functions in the control of the actin cytoskeleton and vacuole morphology. Mol Biol Cell 12(8):2396-411	|SAC1 |STT4
Reviews	McMaster CR (2001) Lipid metabolism and vesicle trafficking: more than just greasing the transport machinery. Biochem Cell Biol 79(6):681-92	|CHO2 |CKI1 |CPT1 |FAB1 |HNM1 |INO2 |INO4 |KES1 |MSS4 |OPI3 |PCT1 |SAC1 |SEC14 |SIT4 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Schorr M, et al. (2001) The phosphoinositide phosphatase Sac1p controls trafficking of the yeast Chs3p chitin synthase. Curr Biol 11(18):1421-6	|CHS3 |SAC1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Audhya A, et al. (2000) Distinct roles for the yeast phosphatidylinositol 4-kinases, Stt4p and Pik1p, in secretion, cell growth, and organelle membrane dynamics. Mol Biol Cell 11(8):2673-89	|ARF1 |HSP150 |STT4 |SUC2
Reviews	Huijbregts RP, et al. (2000) Lipid metabolism and regulation of membrane trafficking. Traffic 1(3):195-202	|DRS2 |FAB1 |KES1 |PEP7 |SAC1 |SEC14 |SEC24 |VPS15 |VPS27 |VPS34
Reviews	Odorizzi G, et al. (2000) Phosphoinositide signaling and the regulation of membrane trafficking in yeast. Trends Biochem Sci 25(5):229-35	|FAB1 |FIG4 |FRQ1 |INP51 |INP52 |INP53 |INP54 |MSS4 |PEP1 |PEP12 |PEP7 |PIB1 |PIB2 |SAC1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hama H, et al. (1999) Direct involvement of phosphatidylinositol 4-phosphate in secretion in the yeast Saccharomyces cerevisiae. J Biol Chem 274(48):34294-300	|SAC1 |SEC14 |STT4 |VPS34
Cellular Location Protein Physical Properties Protein-protein Interactions Regulation of	Hendricks KB, et al. (1999) Yeast homologue of neuronal frequenin is a regulator of phosphatidylinositol-4-OH kinase. Nat Cell Biol 1(4):234-41	|FRQ1
Fungal Related Genes/Proteins	Hull CM and Johnson AD (1999) Identification of a mating type-like locus in the asexual pathogenic yeast Candida albicans. Science 285(5431):1271-5	|HMLALPHA1 |HMLALPHA2 |HMRA1 |MATA |MATA1 |MATALPHA |MATALPHA1 |MATALPHA2
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents	Walch-Solimena C and Novick P (1999) The yeast phosphatidylinositol-4-OH kinase pik1 regulates secretion at the Golgi. Nat Cell Biol 1(8):523-5	|BET3 |SEC4 |SEC5 |SEC8 |YPT1
Non-Fungal Related Genes/Proteins	Xue HW, et al. (1999) A plant 126-kDa phosphatidylinositol 4-kinase with a novel repeat structure. Cloning and functional expression in baculovirus-infected insect cells. J Biol Chem 274(9):5738-45
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Reviews	Fruman DA, et al. (1998) Phosphoinositide kinases. Annu Rev Biochem 67:481-507	|STT4 |VPS34
Mutants/Phenotypes Other Features Strains/Constructs	Cutler NS, et al. (1997) STT4 is an essential phosphatidylinositol 4-kinase that is a target of wortmannin in Saccharomyces cerevisiae. J Biol Chem 272(44):27671-7	|MSS4 |PLC1 |STT4 |VPS3
Reviews	Hsuan JJ and Tan SH (1997) Growth factor-dependent phosphoinositide signalling. Int J Biochem Cell Biol 29(3):415-35	|STT4
Reviews	Hunter T and Plowman GD (1997) The protein kinases of budding yeast: six score and more. Trends Biochem Sci 22(1):18-22	|BUB1 |CAK1 |CLA4 |CTK1 |DBF20 |KIN3 |KIN4 |KKQ8 |MCK1 |MRK1 |NPR1 |RIM11 |SCH9 |SGV1 |MORE
Non-Fungal Related Genes/Proteins	Wong K, et al. (1997) Subcellular locations of phosphatidylinositol 4-kinase isoforms. J Biol Chem 272(20):13236-41	|STT4
Non-Fungal Related Genes/Proteins	Gehrmann T, et al. (1996) Identification of a 200 kDa polypeptide as type 3 phosphatidylinositol 4-kinase from bovine brain by partial protein and cDNA sequencing. Biochim Biophys Acta 1311(1):53-63	|STT4
Non-Fungal Related Genes/Proteins Protein Sequence Features Techniques and Reagents	Nakagawa T, et al. (1996) Cloning, expression, and localization of 230-kDa phosphatidylinositol 4-kinase. J Biol Chem 271(20):12088-94	|STT4
DNA/RNA Sequence Features Mapping	Sen-Gupta M, et al. (1996) The sequence of a 24,152 bp segment from the left arm of chromosome XIV from Saccharomyces cerevisiae between the BNI1 and the POL2 genes. Yeast 12(5):505-14	|ALP1 |BNI1 |LYP1 |PDR16 |POL2
Non-Fungal Related Genes/Proteins	Zhou K, et al. (1995) A phosphatidylinositol (PI) kinase gene family in Dictyostelium discoideum: biological roles of putative mammalian p110 and yeast Vps34p PI 3-kinase homologs during growth and development. Mol Cell Biol 15(10):5645-56	|VPS34
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Garcia-Bustos JF, et al. (1994) PIK1, an essential phosphatidylinositol 4-kinase associated with the yeast nucleus. EMBO J 13(10):2352-61
Fungal Related Genes/Proteins	Buxeda RJ, et al. (1993) Regulation of the 45- and 55-kDa forms of phosphatidylinositol 4-kinase from the yeast Saccharomyces cerevisiae by nucleotides. J Biol Chem 268(9):6248-55	|LSB6 |STT4
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Flanagan CA, et al. (1993) Phosphatidylinositol 4-kinase: gene structure and requirement for yeast cell viability. Science 262(5138):1444-8	|VPS34
Cellular Location Function/Process Non-Fungal Related Genes/Proteins Protein Physical Properties Regulation of Substrates/Ligands/Cofactors Techniques and Reagents	Flanagan CA and Thorner J (1992) Purification and characterization of a soluble phosphatidylinositol 4-kinase from the yeast Saccharomyces cerevisiae. J Biol Chem 267(33):24117-25	|HSC82 |HSP82
Fungal Related Genes/Proteins	Buxeda RJ, et al. (1991) Phosphatidylinositol 4-kinase from Saccharomyces cerevisiae. Kinetic analysis using Triton X-100/phosphatidylinositol-mixed micelles. J Biol Chem 266(21):13859-65	|LSB6 |STT4
Cellular Location Techniques and Reagents	Kinney AJ and Carman GM (1990) Enzymes of phosphoinositide synthesis in secretory vesicles destined for the plasma membrane in Saccharomyces cerevisiae. J Bacteriol 172(7):4115-7	|CDS1 |PIS1

Return to SGD

Send a Message to the SGD Curators