---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BNI4/YNL233W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 211923 to 214601 CDS: 211923 - 214601 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BNI4	YNL233W		ORF, Verified	S000005177
Description
Targeting subunit for Glc7p protein phosphatase, localized to the bud neck, required for localization of chitin synthase III to the bud neck via interaction with the chitin synthase III regulatory subunit Skt5p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Kozubowski L, et al. (2003) A Bni4-Glc7 phosphatase complex that recruits chitin synthase to the site of bud emergence. Mol Biol Cell 14(1):26-39        IDA : Inferred from Direct Assay Assigned on 2003-02-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER-nuclear signaling pathway Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT asymmetric protein localization Kozubowski L, et al. (2003) A Bni4-Glc7 phosphatase complex that recruits chitin synthase to the site of bud emergence. Mol Biol Cell 14(1):26-39        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2005-09-20 SGD barrier septum formation Sanz M, et al. (2004) Saccharomyces cerevisiae Bni4p directs the formation of the chitin ring and also participates in the correct assembly of the septum structure. Microbiology 150(Pt 10):3229-41        IGI : Inferred from Genetic Interaction Assigned on 2004-11-12 SGD cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular cell wall organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT chitin biosynthetic process Sanz M, et al. (2004) Saccharomyces cerevisiae Bni4p directs the formation of the chitin ring and also participates in the correct assembly of the septum structure. Microbiology 150(Pt 10):3229-41        IGI : Inferred from Genetic Interaction TAS : Traceable Author Statement IMP : Inferred from Mutant Phenotype Assigned on 2004-11-12 SGD cofactor transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT response to unfolded protein Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT sexual reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck Sundin BA, et al. (2004) Localization of proteins that are coordinately expressed with Cln2 during the cell cycle. Yeast 21(9):793-800        IDA : Inferred from Direct Assay Assigned on 2004-10-08 SGD cellular bud neck septin collar Kozubowski L, et al. (2005) Role of the septin ring in the asymmetric localization of proteins at the mother-bud neck in Saccharomyces cerevisiae. Mol Biol Cell 16(8):3455-66        IDA : Inferred from Direct Assay Assigned on 2009-11-04 SGD incipient cellular bud site Sanz M, et al. (2004) Saccharomyces cerevisiae Bni4p directs the formation of the chitin ring and also participates in the correct assembly of the septum structure. Microbiology 150(Pt 10):3229-41        IDA : Inferred from Direct Assay Assigned on 2004-11-12 SGD Kozubowski L, et al. (2005) Role of the septin ring in the asymmetric localization of proteins at the mother-bud neck in Saccharomyces cerevisiae. Mol Biol Cell 16(8):3455-66        IDA : Inferred from Direct Assay Assigned on 2009-11-04 SGD septin ring DeMarini DJ, et al. (1997) A septin-based hierarchy of proteins required for localized deposition of chitin in the Saccharomyces cerevisiae cell wall. J Cell Biol 139(1):75-93        IDA : Inferred from Direct Assay IPI : Inferred from Physical Interaction Assigned on 2004-11-12 SGD Kozubowski L, et al. (2005) Role of the septin ring in the asymmetric localization of proteins at the mother-bud neck in Saccharomyces cerevisiae. Mol Biol Cell 16(8):3455-66        IDA : Inferred from Direct Assay Assigned on 2009-11-04 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for BNI4/YNL233W for BNI4 BNI4 encodes a scaffold protein that tethers chitin synthase III (Chs3p) to the bud neck by interacting with septin neck filaments and with Skt5p, which is a regulatory subunit of chitin synthase III (1). Bni4p is also involved in targeting protein phosphatase 1 (Glc7p) to the bud neck before bud emergence (1). Bni4p is required for the assembly of the chitin ring, and is also involved in septum formation and the maintenance of bud neck integrity (2). Bni4p localization is regulated during the cell cycle, with the protein located on the exterior of the septin ring before budding and on the mother side of the collar after budding (3). Proper localization of Bni4p requires the actin cytoskeleton, and binding to Glc7p, since cells containing mutant bni4 that fails to associate with Glc7p display mislocalization of Bni4p (1, 3). Bni4 is phosphorylated in a cell cycle-dependent manner, and inactivation of the protein kinase Hsl1p affects Bni4p localization, but there is no evidence that Hsl1p directly phosphorylates Bni4p (1). bni4 null mutants are viable, but display altered deposition of chitin, and mislocalization of Chs3p, Skt5p, and Glc7p (2, 1). Last Updated: 2005-09-20

Basic References [TOP]

BASIC INFORMATION REFERENCES forBNI4/YNL233W for BNI4 1) Kozubowski L, et al. (2003) A Bni4-Glc7 phosphatase complex that recruits chitin synthase to the site of bud emergence. Mol Biol Cell 14(1):26-39        2) Sanz M, et al. (2004) Saccharomyces cerevisiae Bni4p directs the formation of the chitin ring and also participates in the correct assembly of the septum structure. Microbiology 150(Pt 10):3229-41        3) Kozubowski L, et al. (2005) Role of the septin ring in the asymmetric localization of proteins at the mother-bud neck in Saccharomyces cerevisiae. Mol Biol Cell 16(8):3455-66        4) DeMarini DJ, et al. (1997) A septin-based hierarchy of proteins required for localized deposition of chitin in the Saccharomyces cerevisiae cell wall. J Cell Biol 139(1):75-93

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BNI4/YNL233W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BNI4/YNL233W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSDSISD C-term RCYTHFY Length(aa) 892 MW(Da) 100,589 pI 4.77 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.046   Codon Adaptation Index 0.138   Frequency of Optimal Codons 0.439   Hydropathicity of Protein -0.923   Aromaticity Score 0.061

10 20 30 40 50 | | | | | MSDSISDSKSSELLNSTFYSSTSINTLDHARTFRNSLILKEISDQSLNSS IKPCESVLDRDVESSVLQRSFGESNARDSEVQTVNMTTSPSLSALADILN ERSKYADQKTRKAQNIESSIIEEEEEAEEQNNSINYHEDITGSRLSVREE ANENLAMTSPNLIDIDGSNSIQVAPLSLPSFEEPDFLSTPRVKPDSQGPR SKVSTRRTILERDNNLPVKREENTIINSETESTTHSAPFLKEDPKPSPPS SKLYNPKVRLNKAEARKYTDSSAQRTTSAGSVLEDTSMHKKKKSIFSFLK KKEPKPVIGNNSVTNEKNKMSSSSTFSMNIQTSLKTPEKLKKKSHSSSSI FNSFLKGKIETSDSPRKEPMRQKKRTPKSKDKKQDTEQIIDAASVLSTES PLLRKNHDDTPVKIDHVTRSIDQRKPTPLNMDLILGGDKQINTPLQEHVR EDDDAKNDLQLPTKDNFLSLDYEAPSPAFSKHDTGEVLFPKFLDNHEVDS IVSLERTRSTKSNKRSSMNSQRRSLTDTLSIKAQSEGMFITEASSVVLST PDLTKSPASSILKNGRFEYSDNFSREHSYEGTTNEDFLDIKDDSGPLKKD DIFLESIEQKFDQLVMASDEEKTEVERDVPKPREEPLKKDSERQSVFADD DNELISDIMEFASFINFGDDDLNLDLDLGDTTASYATETPEPVGNDEVNR SGTFDTRNNKEDSYKERETQSYSAAGATTYGDERQGQLHTFEQDGSEIND NEFENEDFNKHIEQPIEVTPRNNAYLPEFEPNRPVSMSFKGLKAPRMNTS FIDSMTPDSPVKSDLTSLGEVYVNSNNDQGVRFSSQIILYDTYGEFEYDR HPEISTCNQLTPQLAQMIKLELNELKSAMEVHDDSRCYTHFY*

Protein Structures from PDB: proteins of known structure with sequence similarity to BNI4/YNL233W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
BNI4	DeMarini DJ, et al. (1997) A septin-based hierarchy of proteins required for localized deposition of chitin in the Saccharomyces cerevisiae cell wall. J Cell Biol 139(1):75-93

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNL233W	SGD Systematic Sequence
855488	NCBI: Gene ID
NP_014166.1	NCBI: RefSeq protein version ID
NP_014166.1	NCBI: RefSeq protein version ID
6324096	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
33 curated references; 0 references not yet curated
Cellular Location Regulation of Strains/Constructs	Gomez A, et al. (2009) Slt2 and Rim101 contribute independently to the correct assembly of the chitin ring at the budding yeast neck in Saccharomyces cerevisiae. Eukaryot Cell 8(9):1449-59	|CCT7 |CDC3 |CHS1 |CHS3 |CTS1 |GFA1 |MYO1 |RIM101 |SKT5 |SLT2
Mutants/Phenotypes Strains/Constructs	Hontz RD, et al. (2009) Genetic Identification of Factors That Modulate Ribosomal DNA Transcription in Saccharomyces cerevisiae. Genetics 182(1):105-19	|AAP1 |ADA2 |AGC1 |ATG2 |BRE1 |CHD1 |CHS6 |CIN1 |CMP2 |DAS2 |DPB11 |ECM29 |FUR4 |GAP1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Regulation of Strains/Constructs	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |CDC10 |MORE
Reviews	Barral Y and Kinoshita M (2008) Structural insights shed light onto septin assemblies and function. Curr Opin Cell Biol 20(1):12-8	|CDC10 |CDC11 |CDC12 |CDC3 |HSL1 |HSL7 |KCC4 |SHS1 |SPR28 |SPR3
Mutants/Phenotypes Strains/Constructs	Bharucha JP, et al. (2008) Saccharomyces cerevisiae Afr1 protein is a protein phosphatase 1/Glc7-targeting subunit that regulates the septin cytoskeleton during mating. Eukaryot Cell 7(8):1246-55	|AFR1 |CDC10 |CDC12 |GLC7
Cellular Location Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Regulatory Role Strains/Constructs	Larson JR, et al. (2008) Protein Phosphatase Type 1 Directs Chitin Synthesis at the Bud Neck in Saccharomyces cerevisiae. Mol Biol Cell 19(7):3040-51	|BNI1 |CDC10 |CHS3 |GLC7
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Genomic expression study RNA Levels and Processing	Yiu G, et al. (2008) Pathways change in expression during replicative aging in Saccharomyces cerevisiae. J Gerontol A Biol Sci Med Sci 63(1):21-34	|AML1 |BUD14 |BUD23 |DIM1 |GAC1 |GCD10 |GLC7 |GLC8 |GSY2 |HXT15 |HXT17 |HXT2 |HXT3 |HXT5 |MORE
Protein Sequence Features	Chang EJ, et al. (2007) Prediction of cyclin-dependent kinase phosphorylation substrates. PLoS One 2(7):e656	|ACC1 |ACE2 |ACM1 |ADY3 |AFI1 |ALY2 |ASE1 |ASH1 |BCK1 |BEM3 |BNI1 |BOI1 |BUD3 |BUD4 |MORE
Function/Process Genetic Interactions	Gray JV and Krause SA (2007) Identifying in vivo pathways using genome-wide genetic networks. Biochem Soc Trans 35(Pt 6):1538-41	|BEM2 |CHS1 |CHS3 |CHS5 |CHS6 |CHS7 |FKS1 |HOC1 |HSP82 |KRE11 |RVS167 |SKT5 |SLT2 |SMI1
Mutants/Phenotypes	Kramer RW, et al. (2007) Yeast functional genomic screens lead to identification of a role for a bacterial effector in innate immunity regulation. PLoS Pathog 3(2):e21	|AFR1 |BMH1 |BNI1 |BRO1 |BUD22 |CCW12 |CDC10 |CDC26 |CNM67 |CWP1 |DAD3 |ECM33 |FIT2 |FIT3 |MORE
Cell Cycle Phase Involved Transcription	Rowicka M, et al. (2007) High-resolution timing of cell cycle-regulated gene expression. Proc Natl Acad Sci U S A 104(43):16892-7	|BUD13 |CDC11 |CDC12 |CDC28 |CDC3 |CLB1 |CLN2 |CLN3 |FKS1 |GAS1 |GAS5 |GIC2 |HHF2 |HHO1 |MORE
Protein-protein Interactions	Walsh EP, et al. (2007) Proteins interacting with Saccharomyces cerevisiae type 1 protein phosphatase catalytic subunit identified by single-step affinity purification and mass spectrometry. Methods Mol Biol 365:235-46	|CFT1 |CFT2 |GIP3 |GLC7 |HER1 |MHP1 |PAP1 |PFS2 |PTA1 |REF2 |RPL27B |RPL3 |RPL4B |SDS22 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gladfelter AS, et al. (2005) Interplay between septin organization, cell cycle and cell shape in yeast. J Cell Sci 118(Pt 8):1617-28	|BNI1 |BNR1 |BUD3 |BUD4 |BUD5 |CDC12 |CDC42 |CLN1 |CLN2 |SWE1
Cellular Location	Kozubowski L, et al. (2005) Role of the septin ring in the asymmetric localization of proteins at the mother-bud neck in Saccharomyces cerevisiae. Mol Biol Cell 16(8):3455-66	|ACT1 |BEM3 |CDC11 |CDC12 |CDC3 |CDC42 |CLA4 |ELM1 |GIN4 |KCC4 |RGA1 |RGA2 |SHS1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lesage G, et al. (2005) An interactional network of genes involved in chitin synthesis in Saccharomyces cerevisiae. BMC Genet 6():8	|CHS1 |CHS3 |CHS5 |CHS6 |CHS7 |SHC1 |SKT5 |YGL081W
Cellular Location Strains/Constructs Techniques and Reagents	Rodal AA, et al. (2005) Actin and septin ultrastructures at the budding yeast cell cortex. Mol Biol Cell 16(1):372-84	|ABP1 |ARP2 |ARP3 |CDC10 |CDC12 |CDC3 |CRN1 |KCC4 |MYO3 |MYO5 |SLA1 |SLA2
Fungal Related Genes/Proteins	Rowbottom L, et al. (2004) Candida albicans mutants in the BNI4 gene have reduced cell-wall chitin and alterations in morphogenesis. Microbiology 150(Pt 10):3243-52
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sanz M, et al. (2004) Saccharomyces cerevisiae Bni4p directs the formation of the chitin ring and also participates in the correct assembly of the septum structure. Microbiology 150(Pt 10):3229-41	|CHS3 |SKT5
Cellular Location	Sundin BA, et al. (2004) Localization of proteins that are coordinately expressed with Cln2 during the cell cycle. Yeast 21(9):793-800	|ALG14 |ASF2 |AXL2 |CSI2 |DPB2 |HSL1 |JEM1 |KCC4 |MCD1 |MPS3 |NBP1 |POL12 |POL30 |PRI2 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs	Kozubowski L, et al. (2003) A Bni4-Glc7 phosphatase complex that recruits chitin synthase to the site of bud emergence. Mol Biol Cell 14(1):26-39	|GLC7 |HSL1 |SKT5
Function/Process Mutants/Phenotypes Strains/Constructs	Rodriguez-Pena JM, et al. (2002) Mechanisms for targeting of the Saccharomyces cerevisiae GPI-anchored cell wall protein Crh2p to polarised growth sites. J Cell Sci 115(Pt 12):2549-58	|CDC10 |CDC15 |CDC42 |CHS5 |CWP1 |RSR1 |SBE2 |SBE22 |UTR2
Function/Process Protein-protein Interactions	Walsh EP, et al. (2002) Novel interactions of Saccharomyces cerevisiae type 1 protein phosphatase identified by single-step affinity purification and mass spectrometry. Biochemistry 41(7):2409-20	|GIP3 |GLC7 |MHP1 |PTA1 |REF2 |SDS22
Mutants/Phenotypes	Stevenson LF, et al. (2001) A large-scale overexpression screen in Saccharomyces cerevisiae identifies previously uncharacterized cell cycle genes. Proc Natl Acad Sci U S A 98(7):3946-51	|ABF1 |ACS2 |ACT1 |ALO1 |ARF1 |ARF2 |BFA1 |BIM1 |CAJ1 |CCC1 |CDC14 |CDC20 |CDC55 |CDH1 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8	|ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Mutants/Phenotypes Strains/Constructs	Capozzo C, et al. (2000) Gene disruption and basic phenotypic analysis of nine novel yeast genes from chromosome XIV. Yeast 16(12):1089-97	|CSL4 |NAF1 |NCS2 |NMA111 |NOP15 |PDR16 |YNL108C |YNL115C
Reviews	Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85	|ABP1 |ACT1 |AIP1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |AXL2 |BEM1 |BNI1 |BNR1 |MORE
Cellular Location Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Ross-Macdonald P, et al. (1999) Large-scale analysis of the yeast genome by transposon tagging and gene disruption. Nature 402(6760):413-8	|AIM23 |CIK1 |CIN1 |CRN1 |ECM33 |IMP2 |MRM1 |NAN1 |NDI1 |NSR1 |OXA1 |PCP1 |PET122 |RIM20 |MORE
Cellular Location	Ayscough KR, et al. (1997) High rates of actin filament turnover in budding yeast and roles for actin in establishment and maintenance of cell polarity revealed using the actin inhibitor latrunculin-A. J Cell Biol 137(2):399-416	|ACT1 |BEM1 |BUD6 |CAP2 |CDC10 |CDC11 |CDC42 |COF1 |END3 |GIN4 |MYO2 |SAC6 |SEC4 |SEC8 |MORE
Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Regulation of Strains/Constructs	DeMarini DJ, et al. (1997) A septin-based hierarchy of proteins required for localized deposition of chitin in the Saccharomyces cerevisiae cell wall. J Cell Biol 139(1):75-93	|CDC10 |CDC11 |CDC12 |CDC3 |CHS3 |SKT5
DNA/RNA Sequence Features Mapping	Pandolfo D, et al. (1996) The DNA sequence of cosmid 14-5 from chromosome XIV reveals 21 open reading frames including a novel gene encoding a globin-like domain. Yeast 12(10B Suppl):1071-6	|ATG2 |CSL4 |HDA1 |JJJ1 |KEX2 |LAP3 |SIN4 |SLA2 |SQS1 |URE2 |YNL234W |YTP1 |ZWF1

Return to SGD

Send a Message to the SGD Curators