ALG9/YNL219C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIV: 237664 to 235997
CDS: 237664 - 235997

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ALG9 YNL219C ORF, Verified S000005163

Description
Mannosyltransferase, involved in N-linked glycosylation; catalyzes the transfer of mannose from Dol-P-Man to lipid-linked oligosaccharides; mutation of the human ortholog causes type 1 congenital disorders of glycosylation

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
mannosyltransferase activity Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2002-11-15 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2009-01-12 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
GPI anchor biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2008-10-13 UniProtKB
dolichol-linked oligosaccharide biosynthetic process Burda P, et al. (1999) Ordered assembly of the asymmetrically branched lipid-linked oligosaccharide in the endoplasmic reticulum is ensured by the substrate specificity of the individual glycosyltransferases. Glycobiology 9(6):617-25
       TAS : Traceable Author Statement
Assigned on 2002-12-20 SGD
peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein amino acid glycosylation Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-11-15 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5
       IMP : Inferred from Mutant Phenotype
ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-11-15 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
intrinsic to endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2009-01-12 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for ALG9/YNL219C for ALG9
During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2).
Alg9p, which is an alpha 1,2 mannosyltransferase, catalyzes two steps in lipid-linked oligosaccharide (LLO) assembly: the addition of the seventh and ninth mannose moieties to the growing oligosaccharide (3, 4) in the lumen of the endoplasmic reticulum. The sixth and eighth mannose moieties are added by Alg3p and Alg12p, respectively. Disruption of ALG9 causes accumulation of lipid-linked oligosaccharides with six mannose residues and hypoglycosylation of secreted proteins (3).

Human ALG9 (OMIM) cDNA complements the deletion of yeast ALG9 in a delta-alg9 wbp1-2 background (4) and has been found to be mutated in the congenital disorder of glycosylation CDG-1L (OMIM).
Last Updated: 2010-01-19

Basic References [TOP]
BASIC INFORMATION REFERENCES forALG9/YNL219C for ALG9
1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50

2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57

3) Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5

4) Frank CG, et al. (2004) Identification and functional analysis of a defect in the human ALG9 gene: definition of congenital disorder of glycosylation type IL. Am J Hum Genet 75(1):146-50

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG9/YNL219C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG9/YNL219C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNCKAVT

C-term KPTETTN

Length(aa) 555

MW(Da) 63,776

pI 8.74

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.106

Codon Adaptation Index 0.156

Frequency of Optimal Codons 0.464

Hydropathicity of Protein 0.335

Aromaticity Score 0.159

10 20 30 40 50 | | | | | MNCKAVTISLLLLLFLTRVYIQPTFSLISDCDETFNYWEPLNLLVRGFGK QTWEYSPEYSIRSWAFLLPFYCILYPVNKFTDLESHWNFFITRACLGFFS FIMEFKLHREIAGSLALQIANIWIIFQLFNPGWFHASVELLPSAVAMLLY VGATRHSLRYLSTGSTSNFTKSLAYNFLASILGWPFVLILSLPLCLHYLF NHRIISTIRTAFDCCLIFSLTAFAVIVTDSIFYGKLAPVSWNILFYNVIN ASEESGPNIFGVEPWYYYPLNLLLNFPLPVLVLAILGIFHLRLWPLWASL FTWIAVFTQQPHKEERFLYPIYGLITLSASIAFYKVLNLFNRKPILKKGI KLSVLLIVAGQAMSRIVALVNNYTAPIAVYEQFSSLNQGGVKAPVVNVCT GREWYHFPSSFLLPDNHRLKFVKSGFDGLLPGDFPESGSIFKKIRTLPKG MNNKNIYDTGKEWPITRCDYFIDIVAPINLTKDVFNPLHLMDNWNKLACA AFIDGENSKILGRAFYVPEPINRIMQIVLPKQWNQVYGVRYIDYCLFEKP TETTN*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG9/YNL219C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ALG9 Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5

Standard Name	Reference
ALG9	*Burda P, et al.* (1996)** Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YNL219C SGD Systematic Sequence

855502 NCBI: Gene ID

NP_014180.1 NCBI: RefSeq protein version ID

NP_014180.1 NCBI: RefSeq protein version ID

6324110 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YNL219C	SGD Systematic Sequence
855502	NCBI: Gene ID
NP_014180.1	NCBI: RefSeq protein version ID
NP_014180.1	NCBI: RefSeq protein version ID
6324110	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
32 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Clerc S, et al. (2009) Htm1 protein generates the N-glycan signal for glycoprotein degradation in the endoplasmic reticulum. J Cell Biol 184(1):159-72
           |ALG12 |ALG3 |ALG8 |MNL1 |MNS1 |PDI1 |PRC1 |ROT2 |YOS9
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Jonikas MC, et al. (2009) Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum. Science 323(5922):1693-7
       |AIM27 |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |CUE1 |DER1 |DIE2 |EMC1 |EMC2 |EMC4 |EMC6 |GET1 |MORE
Other Features
Regulation of
Techniques and Reagents
Transcription
Teste MA, et al. (2009) Validation of reference genes for quantitative expression analysis by real-time RT-PCR in Saccharomyces cerevisiae. BMC Mol Biol 10():99
       |ACT1 |FPR2 |GPH1 |GSY2 |HEM2 |IPP1 |KRE11 |PDA1 |RDN18-1 |RDN18-2 |RPN2 |SGA1 |TAF10 |TDH3 |MORE
Fungal Related Genes/Proteins
Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DIE2 |MORE
Cellular Location
Computational analysis
Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004
       |AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ANP1 |ARL3 |ARP3 |ARP4 |ASK1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Quan EM, et al. (2008) Defining the glycan destruction signal for endoplasmic reticulum-associated degradation. Mol Cell 32(6):870-7
       |ALG12 |MNL1 |YOS9
Mutants/Phenotypes
Strains/Constructs
Zakrzewska A, et al. (2007) Cellular Processes and Pathways That Protect Saccharomyces cerevisiae Cells against the Plasma Membrane-Perturbing Compound Chitosan. Eukaryot Cell 6(4):600-8
         |ALG5 |ALG6 |ALG8 |DID4 |GET1 |GET2 |GET3 |GLO3 |HOG1 |MED1 |PAF1 |PBS2 |RTF1 |SEC22 |MORE
Function/Process
Mutants/Phenotypes
Hancock LC, et al. (2006) Genomic analysis of the Opi- phenotype. Genetics 173(2):621-34
       |AGE2 |APL5 |APL6 |APM3 |APS3 |ARC18 |BSD2 |CHO2 |CKB2 |DEP1 |DID4 |EAF1 |EAF3 |EAF5 |MORE
Fungal Related Genes/Proteins
Protein Sequence Features
Protein-protein Interactions
Hesselberth JR, et al. (2006) Comparative analysis of Saccharomyces cerevisiae WW domains and their interacting proteins. Genome Biol 7(4):R30
         |AUS1 |ESS1 |PRP40 |RSP5 |SET2 |SSM4 |URN1 |VID30 |WWM1
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |DIE2 |DPM1 |OST1 |MORE
Reviews
Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R
       |ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Mutants/Phenotypes
Chen Y, et al. (2005) Identification of mitogen-activated protein kinase signaling pathways that confer resistance to endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Cancer Res 3(12):669-77
       |ALG3 |ALG8 |ARD1 |BCK1 |CMR2 |CNB1 |DAL81 |DID2 |EDE1 |ERV25 |FPS1 |FYV8 |HAC1 |HOG1 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |BIG1 |MORE
Function/Process
Mutants/Phenotypes
Szathmary R, et al. (2005) Yos9 protein is essential for degradation of misfolded glycoproteins and may function as lectin in ERAD. Mol Cell 19(6):765-75
         |ALG12 |ALG3 |MNL1 |MNS1 |PRC1 |YOS9
Cross-species Expression
Disease Gene Related
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Weinstein M, et al. (2005) CDG-IL: an infant with a novel mutation in the ALG9 gene and additional phenotypic features. Am J Med Genet A 136(2):194-7

Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Care A, et al. (2004) A synthetic lethal screen identifies a role for the cortical actin patch/endocytosis complex in the response to nutrient deprivation in Saccharomyces cerevisiae. Genetics 166(2):707-19
       |ARK1 |FEN2 |PRK1 |PRS3 |SIW14 |SLT2 |THR4 |WHI2 |ZDS1
Cross-species Expression
Disease Gene Related
Function/Process
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Frank CG, et al. (2004) Identification and functional analysis of a defect in the human ALG9 gene: definition of congenital disorder of glycosylation type IL. Am J Hum Genet 75(1):146-50

Function/Process
Mutants/Phenotypes
Strains/Constructs
Conde R, et al. (2003) Screening for new yeast mutants affected in mannosylphosphorylation of cell wall mannoproteins. Yeast 20(14):1189-211
         |ALG12 |BRE5 |COG5 |COG7 |COG8 |CYK3 |ELP2 |EXG1 |HOC1 |ITC1 |KTR6 |LCL2 |LDB7 |MNN1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Avaro S, et al. (2002) Mutants defective in secretory/vacuolar pathways in the EUROFAN collection of yeast disruptants. Yeast 19(4):351-71
         |ALG12 |APM3 |ERV29 |GAS1 |MON2 |OST2 |OST4 |RCY1 |ROT2 |SYS1 |TLG2 |VAC7 |VAM6 |VPS53 |MORE
Disease Gene Related
Non-Fungal Related Genes/Proteins
Baysal BE, et al. (2002) A mannosyltransferase gene at 11q23 is disrupted by a translocation breakpoint that co-segregates with bipolar affective disorder in a small family. Neurogenetics 4(1):43-53

Function/Process
Mutants/Phenotypes
Strains/Constructs
Cipollo JF and Trimble RB (2002) Hypoglycosylation in the alg12delta yeast mutant destabilizes protease A and causes proteolytic loss of external invertase. Glycobiology 12(11):30G-3G
       |ALG12 |PEP4 |SUC2
Function/Process
Cipollo JF and Trimble RB (2002) The Saccharomyces cerevisiae alg12delta mutant reveals a role for the middle-arm alpha1,2Man- and upper-arm alpha1,2Manalpha1,6Man- residues of Glc3Man9GlcNAc2-PP-Dol in regulating glycoprotein glycan processing in the endoplasmic reticulum and Golgi apparatus. Glycobiology 12(11):749-62
       |ALG12 |MNS1
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Grimme SJ, et al. (2001) The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols. J Biol Chem 276(29):27731-9
       |ALG12 |GAA1 |GPI1 |GPI10 |GPI11 |GPI13 |SMP3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Muren E, et al. (2001) Identification of yeast deletion strains that are hypersensitive to brefeldin A or monensin, two drugs that affect intracellular transport. Yeast 18(2):163-72
       |ALG12 |BRE1 |BRE2 |BRE4 |BRE5 |ENT4 |ERG4 |HOS2 |IRC20 |LEM3 |LSM1 |MON1 |MON2 |NOP6 |MORE
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Brachat A, et al. (2000) Analysis of deletion phenotypes and GFP fusions of 21 novel Saccharomyces cerevisiae open reading frames. Yeast 16(3):241-53
       |ARK1 |ATG4 |CNM67 |EOS1 |FAP1 |HDA1 |IMP4 |NIS1 |RNH201 |SAM50 |SIW14 |SQS1 |SWS2 |YNL018C |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Cipollo JF and Trimble RB (2000) The accumulation of Man(6)GlcNAc(2)-PP-dolichol in the Saccharomyces cerevisiae Deltaalg9 mutant reveals a regulatory role for the Alg3p alpha1,3-Man middle-arm addition in downstream oligosaccharide-lipid and glycoprotein glycan processing. J Biol Chem 275(6):4267-77
       |ALG3 |ALG6 |ALG8 |CWH41 |DIE2 |OCH1 |ROT2 |SEC18
Fungal Related Genes/Proteins
Canivenc-Gansel E, et al. (1998) GPI anchor biosynthesis in yeast: phosphoethanolamine is attached to the alpha1,4-linked mannose of the complete precursor glycophospholipid. Glycobiology 8(8):761-70
       |ALG12 |GPI10 |SMP3
Substrates/Ligands/Cofactors
Jakob CA, et al. (1998) Degradation of misfolded endoplasmic reticulum glycoproteins in Saccharomyces cerevisiae is determined by a specific oligosaccharide structure. J Cell Biol 142(5):1223-33
       |ALG12 |MNS1 |PRC1 |ROT2
Mutants/Phenotypes
Lussier M, et al. (1997) Large scale identification of genes involved in cell surface biosynthesis and architecture in Saccharomyces cerevisiae. Genetics 147(2):435-50
     |ACS1 |ALG12 |ARG7 |ATG32 |BUD8 |COX11 |CWP2 |DCG1 |DFG16 |DIT2 |ECM10 |ECM11 |ECM12 |ECM13 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Techniques and Reagents
Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5
       |ALG3 |WBP1
Mutants/Phenotypes
Techniques and Reagents
Zufferey R, et al. (1995) STT3, a highly conserved protein required for yeast oligosaccharyl transferase activity in vivo. EMBO J 14(20):4949-60
     |ALG3 |ALG5 |ALG6 |ALG8 |DIE2 |STT3 |WBP1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.