---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BNI5/YNL166C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 323567 to 322221 CDS: 323567 - 322221 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BNI5	YNL166C		ORF, Verified	S000005110
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 1999-04-06. Gene name expires on 2002-10-18.
Description
Protein involved in organization of septins at the mother-bud neck, may interact directly with the Cdc11p septin, localizes to bud neck in a septin-dependent manner

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-09-26 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular cell wall organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cytokinesis Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20        IGI : Inferred from Genetic Interaction Assigned on 2002-09-26 SGD reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT septin ring assembly Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20        IGI : Inferred from Genetic Interaction IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2003-03-21 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0027 Assigned on 2008-02-13 UniProtKB cellular bud neck Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20        IDA : Inferred from Direct Assay Assigned on 2002-09-26 SGD cellular bud neck septin ring Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20        IPI : Inferred from Physical Interaction IDA : Inferred from Direct Assay Assigned on 2002-09-26 SGD cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0086 Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBNI5/YNL166C for BNI5 1) Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BNI5/YNL166C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BNI5/YNL166C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MGLDQDK C-term QFWIGTK Length(aa) 448 MW(Da) 49,694 pI 4.63 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.007   Codon Adaptation Index 0.129   Frequency of Optimal Codons 0.427   Hydropathicity of Protein -0.981   Aromaticity Score 0.042

10 20 30 40 50 | | | | | MGLDQDKIKKRLSQIEIDINQMNQMIDENLQLVEPAEDEAVEDNVKDTGV VDAVKVAETALFSGNDGADSNPGDSAQVEEHKTAQVHIPTENEANKSTDD PSQLSVTQPFIAKEQITHTAIAIGDSYNSFVANSAGNEKAKDSCTENKED GTVNIDQNRGEADVEIIENNDDEWEDEKSDVEEGRVDKGTEENSEIESFK SPMPQNNTLGGENKLDAELVLDKFSSANKDLDIQPQTIVVGGDNEYNHES SRLADQTPHDDNSENCPNRSGGSTPLDSQTKIFIPKKNSKEDGTNINHFN SDGDGQKKMANFETRRPTNPFRVISVSSNSNSRNGSRKSSLNKYDSPVSS PITSASELGSIAKLEKRHDYLSMKCIKLQKEIDYLNKMNAQGSLSMEDGK RLHRAVVKLQEYLDKKTKEKYEVGVLLSRHLRKQIDRGENGQFWIGTK*

Protein Structures from PDB: proteins of known structure with sequence similarity to BNI5/YNL166C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
BNI5	2002-09-26	Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNL166C	SGD Systematic Sequence
855555	NCBI: Gene ID
NP_014233.1	NCBI: RefSeq protein version ID
NP_014233.1	NCBI: RefSeq protein version ID
6324163	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
11 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nishihama R, et al. (2009) Role of Inn1 and its interactions with Hof1 and Cyk3 in promoting cleavage furrow and septum formation in S. cerevisiae. J Cell Biol 185(6):995-1012	|BNI1 |CDC12 |CDC14 |CDC5 |CHS2 |CYK3 |ELM1 |GIN4 |HOF1 |INN1 |IQG1 |MLC1 |MYO1 |PSA1
Mutants/Phenotypes	Gresham D, et al. (2008) The repertoire and dynamics of evolutionary adaptations to controlled nutrient-limited environments in yeast. PLoS Genet 4(12):e1000303	|ADH2 |BRR2 |CCR4 |CIT2 |CIT3 |CKA2 |CST9 |DCI1 |ERG1 |GIN4 |GSH1 |HXT1 |HXT2 |HXT3 |MORE
Cell Cycle Phase Involved Cellular Location Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs	Nam SC, et al. (2007) Phosphorylation-Dependent Septin Interaction of Bni5 is Important for Cytokinesis. J Microbiol 45(3):227-33	|CDC11 |CDC12 |HOF1
Cell Cycle Phase Involved Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of Strains/Constructs	Nam SC, et al. (2007) Requirement of Bni5 Phosphorylation for Bud Morphogenesis in Saccharomyces cerevisiae. J Microbiol 45(1):34-40	|CDC11 |CDC12 |CDC14 |CDC15 |SWE1
Mutants/Phenotypes Strains/Constructs	Lee W, et al. (2005) Genome-wide requirements for resistance to functionally distinct DNA-damaging agents. PLoS Genet 1(2):e24	|CSM2 |DDC1 |DRS2 |HRQ1 |IRC21 |MAG1 |MEC3 |MMS1 |MPH1 |MUS81 |NTO1 |PSY1 |PSY3 |RAD1 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Reviews	Longtine MS and Bi E (2003) Regulation of septin organization and function in yeast. Trends Cell Biol 13(8):403-9	|BEM3 |CDC10 |CDC11 |CDC12 |CDC24 |CDC3 |CDC42 |CLA4 |ELM1 |GIN4 |LTE1 |RGA1 |RGA2 |RTS1 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Strains/Constructs	Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20	|CDC10 |CDC11 |CDC12 |CDC3 |HOF1 |SHS1
Protein-protein Interactions	Mortensen EM, et al. (2002) Cell cycle-dependent assembly of a Gin4-septin complex. Mol Biol Cell 13(6):2091-105	|CDC10 |CDC11 |CDC12 |CDC28 |CDC3 |CLA4 |ELM1 |GIN4 |NAP1 |SHS1
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Duenas E, et al. (1999) Disruption and basic phenotypic analysis of six novel genes from the left arm of chromosome XIV of Saccharomyces cerevisiae. Yeast 15(1):63-72	|ASI2 |FMP41 |IBD2 |PGA1 |YNL155W

Return to SGD

Send a Message to the SGD Curators