---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ASI2/YNL159C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIV: 339349 to 338480 CDS: 339349 - 338480 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ASI2	YNL159C		ORF, Verified	S000005103
Description
Integral inner nuclear membrane protein that acts with Asi1p and Asi3p to ensure the fidelity of SPS-sensor signalling by maintaining the dormant repressed state of gene expression in the absence of inducing signals

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-08-24 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ubiquitin-dependent protein catabolic process Forsberg H, et al. (2001) Suppressors of ssy1 and ptr3 null mutations define novel amino acid sensor-independent genes in Saccharomyces cerevisiae. Genetics 158(3):973-88        IGI : Inferred from Genetic Interaction Assigned on 2001-08-24 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB nuclear inner membrane Zargari A, et al. (2007) Inner nuclear membrane proteins asi1, asi2, and asi3 function in concert to maintain the latent properties of transcription factors stp1 and stp2. J Biol Chem 282(1):594-605        IDA : Inferred from Direct Assay Assigned on 2006-11-20 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forASI2/YNL159C for ASI2 1) Forsberg H, et al. (2001) Suppressors of ssy1 and ptr3 null mutations define novel amino acid sensor-independent genes in Saccharomyces cerevisiae. Genetics 158(3):973-88        2) Zargari A, et al. (2007) Inner nuclear membrane proteins asi1, asi2, and asi3 function in concert to maintain the latent properties of transcription factors stp1 and stp2. J Biol Chem 282(1):594-605

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ASI2/YNL159C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ASI2/YNL159C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MARPQNH C-term ITGPGVF Length(aa) 289 MW(Da) 32,985 pI 10.37 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.048   Codon Adaptation Index 0.099   Frequency of Optimal Codons 0.378   Hydropathicity of Protein -0.149   Aromaticity Score 0.128

10 20 30 40 50 | | | | | MARPQNHRRSNWTERDDNDDYLFQRFLEESETRHSREPSPVTEQSQQELQ QDVQQAIDGIFNSLRRNMSSTSNINRAANMDATTNGNGGINADTIRATNA NTADSPFTARQQSPLRTFLRNLFILDYFIGLILFPFSVYNILRSGFNSMT FSENDFIIEIVGYWKFAKIFGSGGTTLIAYKDTGKLGLLGKFHNIIVFYS SPVIKHIMKSRDGNEPNLNWIRLMFAKAFELFVKVSTILIYLAYGVSGTV YMVTAGFFFVLCLLFTVIRRYKGVHRMLVSQRITGPGVF*

Protein Structures from PDB: proteins of known structure with sequence similarity to ASI2/YNL159C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ASI2	Forsberg H, et al. (2001) Suppressors of ssy1 and ptr3 null mutations define novel amino acid sensor-independent genes in Saccharomyces cerevisiae. Genetics 158(3):973-88

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YNL159C	SGD Systematic Sequence
855563	NCBI: Gene ID
NP_014240.1	NCBI: RefSeq protein version ID
NP_014240.1	NCBI: RefSeq protein version ID
6324170	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
5 curated references; 0 references not yet curated
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Boban M and Ljungdahl PO (2007) Dal81 Enhances Stp1- and Stp2-Dependent Transcription Necessitating Negative Modulation by Inner Nuclear Membrane Protein Asi1 in Saccharomyces cerevisiae. Genetics 176(4):2087-97	|ASI1 |ASI3 |DAL81 |PTR3 |SSY1 |SSY5 |STP1 |STP2
Cellular Location Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Zargari A, et al. (2007) Inner nuclear membrane proteins asi1, asi2, and asi3 function in concert to maintain the latent properties of transcription factors stp1 and stp2. J Biol Chem 282(1):594-605	|ASI1 |ASI3 |STP1 |STP2
Function/Process Mutants/Phenotypes Strains/Constructs	Forsberg H, et al. (2001) Suppressors of ssy1 and ptr3 null mutations define novel amino acid sensor-independent genes in Saccharomyces cerevisiae. Genetics 158(3):973-88	|AGP1 |ASI1 |ASI3 |BRO1 |BUL1 |CYC8 |DOA4 |PTR3 |RSP5 |SSY1 |TUP1 |UBA1 |VPS20 |VPS36
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |BNI4 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Duenas E, et al. (1999) Disruption and basic phenotypic analysis of six novel genes from the left arm of chromosome XIV of Saccharomyces cerevisiae. Yeast 15(1):63-72	|BNI5 |FMP41 |IBD2 |PGA1 |YNL155W

Return to SGD

Send a Message to the SGD Curators