ALG11/YNL048W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIV: 538175 to 539821
CDS: 538175 - 539821

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ALG11 YNL048W ORF, Verified S000004993

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1997-05-30. Gene name expires on 2000-03-23.
Description
Alpha-1,2-mannosyltransferase, catalyzes sequential addition of the two terminal alpha 1,2-mannose residues to the Man5GlcNAc2-PP-dolichol intermediate during asparagine-linked glycosylation in the ER

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
alpha-1,2-mannosyltransferase activity Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40
       IGI : Inferred from Genetic Interaction
Assigned on 2001-06-22 SGD
O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603
       IDA : Inferred from Direct Assay
Assigned on 2007-04-17 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001296
Assigned on 2007-05-23 UniProtKB
oligosaccharide-lipid intermediate assembly O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603
       IDA : Inferred from Direct Assay
Assigned on 2007-04-17 SGD
protein amino acid glycosylation Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40
       IGI : Inferred from Genetic Interaction
Assigned on 2001-06-22 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40
       IDA : Inferred from Direct Assay
Assigned on 2001-06-22 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9906
Assigned on 2009-10-01 UniProtKB
membrane Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40
       IDA : Inferred from Direct Assay
Assigned on 2007-04-17 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for ALG11/YNL048W for ALG11
During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2).
ALG11 encodes an alpha 1,2 mannosyltransferase that catalyzes two sequential steps in oligosaccharide-lipid intermediate assembly: the addition of the fourth and fifth mannose residues to growing lipid-linked oligosaccharides (LLO's) on the cytosolic side of the ER (3). Afterwards, Rft1p flips the LLO into the ER lumen, where it is extended further. Truncated alg11-1 LLO's with three or four mannose residues are flipped into the ER and partially extended, leading to the accumulation of LLO's with seven mannose residues. ALG11 is needed for normal growth at 25° C and is essential at 37° C (4). Alg11p and its closest homolog, Alg2p, each form complexes with Alg1p, but not with each other (5). ALG11 restores function to S. pombe mutants lacking the ALG11 homolog gmd3 (6).
Last Updated: 2007-04-17

Basic References [TOP]
BASIC INFORMATION REFERENCES forALG11/YNL048W for ALG11
1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50

2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57

3) O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603

4) Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40

5) Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70

6) Umeda K, et al. (2000) Schizosaccharomyces pombe gmd3(+)/alg11(+) is a functional homologue of Saccharomyces cerevisiae ALG11 which is involved in N-linked oligosaccharide synthesis. Yeast 16(14):1261-71

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG11/YNL048W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG11/YNL048W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MGSAWTN

C-term LEEEERG

Length(aa) 548

MW(Da) 63,143

pI 9.7

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.013

Codon Adaptation Index 0.144

Frequency of Optimal Codons 0.429

Hydropathicity of Protein -0.179

Aromaticity Score 0.133

10 20 30 40 50 | | | | | MGSAWTNYNFEEVKSHFGFKKYVVSSLVLVYGLIKVLTWIFRQWVYSSLN PFSKKSSLLNRAVASCGEKNVKVFGFFHPYCNAGGGGEKVLWKAVDITLR KDAKNVIVIYSGDFVNGENVTPENILNNVKAKFDYDLDSDRIFFISLKLR YLVDSSTWKHFTLIGQAIGSMILAFESIIQCPPDIWIDTMGYPFSYPIIA RFLRRIPIVTYTHYPIMSKDMLNKLFKMPKKGIKVYGKILYWKVFMLIYQ SIGSKIDIVITNSTWTNNHIKQIWQSNTCKIIYPPCSTEKLVDWKQKFGT AKGERLNQAIVLAQFRPEKRHKLIIESFATFLKNLPDSVSPIKLIMAGST RSKQDENYVKSLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVN AMWNEHFGIAVVEYMASGLIPIVHASAGPLLDIVTPWDANGNIGKAPPQW ELQKKYFAKLEDDGETTGFFFKEPSDPDYNTTKDPLRYPNLSDLFLQITK LDYDCLRVMGARNQQYSLYKFSDLKFDKDWENFVLNPICKLLEEEERG*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG11/YNL048W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ALG11 2001-02-06 Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40

Mapping Notes
Date Note
1996-09-21 Edition 13: The Alg11p is associates with membranes and localizes to the endoplasmic reticulum.
Cherry JM, et al. (1996) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Standard Name	Date Standardized	Reference
ALG11	2001-02-06	*Cipollo JF, et al.* (2001)** The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40

Date	Note
1996-09-21	Edition 13: The Alg11p is associates with membranes and localizes to the endoplasmic reticulum. *Cherry JM, et al.* (1996)** "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YNL048W SGD Systematic Sequence

855679 NCBI: Gene ID

NP_014350.1 NCBI: RefSeq protein version ID

NP_014350.1 NCBI: RefSeq protein version ID

6324280 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YNL048W	SGD Systematic Sequence
855679	NCBI: Gene ID
NP_014350.1	NCBI: RefSeq protein version ID
NP_014350.1	NCBI: RefSeq protein version ID
6324280	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
12 curated references; 0 references not yet curated
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Substrates/Ligands/Cofactors
Absmanner B, et al. (2009) Biochemical characterization, membrane association and identification of amino acids essential for function of Alg11 from Saccharomyces cerevisiae, an alpha1,2-mannosyltransferase, catalyzing two sequential glycosylation steps in the formation of the lipid-linked core oligosaccharide. Biochem J

Non-Fungal Related Genes/Proteins
Zhang M, et al. (2009) LEW3, encoding a putative alpha-1,2-mannosyltransferase (ALG11) in N-linked glycoprotein, plays vital roles in cell-wall biosynthesis and the abiotic stress response in Arabidopsis thaliana. Plant J 60(6):983-99

Fungal Related Genes/Proteins
Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37
       |ALG1 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Strains/Constructs
Substrates/Ligands/Cofactors
O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603
       |ALG1 |ALG2
Reviews
Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R
       |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53
         |ALG1 |ALG2 |ALG5 |ALG7 |DPM1 |STT3
Cellular Location
Protein-protein Interactions
Strains/Constructs
Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70
             |ALG1 |ALG2
Reviews
Parodi AJ (2002) Protein sweetener. Nature 415(6870):382-3
           |RFT1
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Strains/Constructs
Techniques and Reagents
Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40
       |ALG2 |ALG3 |OCH1
Fungal Related Genes/Proteins
Genetic Interactions
Protein Sequence Features
Strains/Constructs
Umeda K, et al. (2000) Schizosaccharomyces pombe gmd3(+)/alg11(+) is a functional homologue of Saccharomyces cerevisiae ALG11 which is involved in N-linked oligosaccharide synthesis. Yeast 16(14):1261-71

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.