RCE1/YMR274C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 815310 to 814363
CDS: 815310 - 814363

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

RCE1 YMR274C ORF, Verified S000004887

Description
Type II CAAX prenyl protease involved in the proteolysis and maturation of Ras and the a-factor mating pheromone

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0378
Assigned on 2007-05-23 UniProtKB
metalloendopeptidase activity Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800
       IDA : Inferred from Direct Assay
IMP : Inferred from Mutant Phenotype
Assigned on 2008-08-19 SGD
Manandhar SP, et al. (2007) Small-molecule inhibitors of the Rce1p CaaX protease. J Biomol Screen 12(7):983-93
         IDA : Inferred from Direct Assay
Assigned on 2008-09-30 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
CAAX-box protein maturation Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-08-12 SGD
peptide pheromone maturation Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-17 SGD
protein processing Trueblood CE, et al. (2000) The CaaX proteases, Afc1p and Rce1p, have overlapping but distinct substrate specificities. Mol Cell Biol 20(12):4381-92
       IDA : Inferred from Direct Assay
Assigned on 2002-07-17 SGD
response to pheromone GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0589
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to endoplasmic reticulum membrane Schmidt WK, et al. (1998) Endoplasmic reticulum membrane localization of Rce1p and Ste24p, yeast proteases involved in carboxyl-terminal CAAX protein processing and amino-terminal a-factor cleavage. Proc Natl Acad Sci U S A 95(19):11175-80
       IDA : Inferred from Direct Assay
Assigned on 2002-07-17 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003675
Assigned on 2008-06-13 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forRCE1/YMR274C for RCE1
1) Trueblood CE, et al. (2000) The CaaX proteases, Afc1p and Rce1p, have overlapping but distinct substrate specificities. Mol Cell Biol 20(12):4381-92

2) Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800

3) Pei J and Grishin NV (2001) Type II CAAX prenyl endopeptidases belong to a novel superfamily of putative membrane-bound metalloproteases. Trends Biochem Sci 26(5):275-7

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for RCE1/YMR274C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for RCE1/YMR274C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MLQFSTF

C-term PGYRITL

Length(aa) 315

MW(Da) 35,911

pI 9.02

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.025

Codon Adaptation Index 0.094

Frequency of Optimal Codons 0.380

Hydropathicity of Protein 0.450

Aromaticity Score 0.143

10 20 30 40 50 | | | | | MLQFSTFLVLLYISISYVLPLYATSQPEGSKRDNPRTIKSRMQKLTIMLI SNLFLVPFLQSQLSSTTSHISFKDAFLGLGIIPGYYAALPNPWQFSQFVK DLTKCVAMLLTLYCGPVLDFVLYHLLNPKSSILEDFYHEFLNIWSFRNFI FAPITEEIFYTSMLLTTYLNLIPHSQLSYQQLFWQPSLFFGLAHAHHAYE QLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRTGGNLWCCIILHAL CNIMGFPGPSRLNLHFTVVDKKAGRISKLVSIWNKCYFALLVLGLISLKD TLQTLVGTPGYRITL*

Protein Structures from PDB: proteins of known structure with sequence similarity to RCE1/YMR274C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
RCE1 Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800

Standard Name	Reference
RCE1	*Boyartchuk VL, et al.* (1997)** Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YMR274C SGD Systematic Sequence

855317 NCBI: Gene ID

NP_014001.1 NCBI: RefSeq protein version ID

NP_014001.1 NCBI: RefSeq protein version ID

6323930 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YMR274C	SGD Systematic Sequence
855317	NCBI: Gene ID
NP_014001.1	NCBI: RefSeq protein version ID
NP_014001.1	NCBI: RefSeq protein version ID
6323930	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
32 curated references; 0 references not yet curated
Strains/Constructs
Techniques and Reagents
Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif
       |AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |MORE
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Krishnankutty RK, et al. (2009) Proteolytic processing of certain CaaX motifs can occur in the absence of the Rce1p and Ste24p CaaX proteases. Yeast 26(8):451-63
       |AXL1 |MFA1 |MOH1 |MRPS8 |NAP1 |PEX19 |POP8 |REC1 |SAM37 |STE14 |STE23 |STE24 |VPS71 |VTI1 |MORE
Cross-species Expression
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Regulatory Role
Mokry DZ, et al. (2009) Heterologous expression studies of Saccharomyces cerevisiae reveal two distinct trypanosomatid CaaX protease activities and identify their potential targets. Eukaryot Cell 8(12):1891-900
       |RAS2 |STE24 |YDJ1
Cross-species Expression
Non-Fungal Related Genes/Proteins
Bracha-Drori K, et al. (2008) Functional Analysis of Arabidopsis Postprenylation CaaX Processing Enzymes and Their Function in Subcellular Protein Targeting. Plant Physiol 148(1):119-31
       |STE14 |STE24
Function/Process
Protein Physical Properties
Substrates/Ligands/Cofactors
Manandhar SP, et al. (2007) Small-molecule inhibitors of the Rce1p CaaX protease. J Biomol Screen 12(7):983-93
         |STE14 |STE24
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Huyer G, et al. (2006) Saccharomyces cerevisiae a-factor mutants reveal residues critical for processing, activity, and export. Eukaryot Cell 5(9):1560-70
       |AXL1 |MFA1 |MFA2 |RAM1 |STE14 |STE24 |STE3 |STE6
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Strains/Constructs
Plummer LJ, et al. (2006) Mutational analysis of the ras converting enzyme reveals a requirement for glutamate and histidine residues. J Biol Chem 281(8):4596-605
       |MFA1 |MFA2 |STE24
Fungal Related Genes/Proteins
Fabre E, et al. (2005) Comparative genomics in hemiascomycete yeasts: evolution of sex, silencing, and subtelomeres. Mol Biol Evol 22(4):856-73
         |ABF1 |ASH1 |AXL1 |CDC24 |DOT1 |ESA1 |ESC1 |FAR1 |FUS3 |GCN5 |HMLALPHA1 |HMLALPHA2 |HMRA1 |HMRA2 |MORE
Mapping
Protein-Nucleic Acid Interactions
Regulation of
Lynch PJ, et al. (2005) Sum1p, the origin recognition complex, and the spreading of a promoter-specific repressor in Saccharomyces cerevisiae. Mol Cell Biol 25(14):5920-32
       |ARS1013 |ARS1015 |BAR1 |DCG1 |FYV7 |HHF1 |HHF2 |HML |HMR |HST1 |KAR1 |LOH1 |LSM2 |MLP2 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cross-species Expression
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Agarwal AK, et al. (2003) Zinc metalloproteinase, ZMPSTE24, is mutated in mandibuloacral dysplasia. Hum Mol Genet 12(16):1995-2001
       |STE24
Cross-species Expression
Non-Fungal Related Genes/Proteins
Cadinanos J, et al. (2003) AtFACE-2, a functional prenylated protein protease from Arabidopsis thaliana related to mammalian Ras-converting enzymes. J Biol Chem 278(43):42091-7

Non-Fungal Related Genes/Proteins
Cadinanos J, et al. (2003) Identification, functional expression and enzymic analysis of two distinct CaaX proteases from Caenorhabditis elegans. Biochem J 370(Pt 3):1047-54
       |STE24
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Tipper DJ and Harley CA (2002) Yeast genes controlling responses to topogenic signals in a model transmembrane protein. Mol Biol Cell 13(4):1158-74
       |BMH1 |PMR1 |SPF1 |STE24 |YPK9
Techniques and Reagents
Dolence EK, et al. (2001) Solid-phase synthesis of a radiolabeled, biotinylated, and farnesylated Ca(1)a(2)X peptide substrate for Ras- and a-mating factor converting enzyme. Bioconjug Chem 12(1):35-43

Non-Fungal Related Genes/Proteins
Leung GK, et al. (2001) Biochemical studies of Zmpste24-deficient mice. J Biol Chem 276(31):29051-8
       |STE24
Non-Fungal Related Genes/Proteins
Reviews
Pei J and Grishin NV (2001) Type II CAAX prenyl endopeptidases belong to a novel superfamily of putative membrane-bound metalloproteases. Trends Biochem Sci 26(5):275-7

Other Features
Substrates/Ligands/Cofactors
Dolence EK, et al. (2000) Solid-phase synthesis of a farnesylated CaaX peptide library: inhibitors of the Ras CaaX endoprotease. J Comb Chem 2(5):522-36

Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Techniques and Reagents
Dolence JM, et al. (2000) Studies with recombinant Saccharomyces cerevisiae CaaX prenyl protease Rce1p. Biochemistry 39(14):4096-104
       |RAS2 |RHO2 |STE24
Non-Fungal Related Genes/Proteins
Hollander I, et al. (2000) Human ras-converting enzyme (hRCE1) endoproteolytic activity on K-ras-derived peptides. Anal Biochem 286(1):129-37

Other Features
Reviews
Sinensky M (2000) Recent advances in the study of prenylated proteins. Biochim Biophys Acta 1484(2-3):93-106
       |AXL1 |RAS2 |STE14 |STE24
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Trueblood CE, et al. (2000) The CaaX proteases, Afc1p and Rce1p, have overlapping but distinct substrate specificities. Mol Cell Biol 20(12):4381-92
       |MFA1 |STE24 |YGL082W
Genomic expression study
Regulation of
Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60
       |ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Non-Fungal Related Genes/Proteins
Kim E, et al. (1999) Disruption of the mouse Rce1 gene results in defective Ras processing and mislocalization of Ras within cells. J Biol Chem 274(13):8383-90

Function/Process
Non-Fungal Related Genes/Proteins
Substrates/Ligands/Cofactors
Techniques and Reagents
Otto JC, et al. (1999) Cloning and characterization of a mammalian prenyl protein-specific protease. J Biol Chem 274(13):8379-82

Reviews
Ashby MN (1998) CaaX converting enzymes. Curr Opin Lipidol 9(2):99-102
     |STE24
Function/Process
Mutants/Phenotypes
Strains/Constructs
Boyartchuk VL and Rine J (1998) Roles of prenyl protein proteases in maturation of Saccharomyces cerevisiae a-factor. Genetics 150(1):95-101
       |AXL1 |MFA1 |STE23 |STE24
Cellular Location
Function/Process
Protein Sequence Features
Schmidt WK, et al. (1998) Endoplasmic reticulum membrane localization of Rce1p and Ste24p, yeast proteases involved in carboxyl-terminal CAAX protein processing and amino-terminal a-factor cleavage. Proc Natl Acad Sci U S A 95(19):11175-80
       |RAM1 |RAM2 |STE14 |STE24
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tam A, et al. (1998) Dual roles for Ste24p in yeast a-factor maturation: NH2-terminal proteolysis and COOH-terminal CAAX processing. J Cell Biol 142(3):635-49
       |AXL1 |MFA1 |MFA2 |STE24
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800
       |MFA1 |MFA2 |STE24
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gelb MH (1997) Protein prenylation, et cetera: signal transduction in two dimensions. Science 275(5307):1750-1
       |MFA1 |RAS2 |STE24

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.