---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CUE1/YMR264W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 795804 to 796415 CDS: 795804 - 796415 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CUE1	YMR264W	KIS4	ORF, Verified	S000004877
Description
Endoplasmic reticulum membrane protein that recruits the ubiquitin-conjugating enzyme Ubc7p to the ER where it functions in protein degradation; contains a CUE domain that binds ubiquitin to facilitate intramolecular monoubiquitination

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9        IDA : Inferred from Direct Assay Assigned on 2002-07-15 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER-associated protein catabolic process Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9        IMP : Inferred from Mutant Phenotype Assigned on 2002-07-15 SGD establishment of protein localization Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9        IMP : Inferred from Mutant Phenotype Assigned on 2002-07-15 SGD modification-dependent protein catabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0833 Assigned on 2009-03-04 UniProtKB translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Doa10p ubiquitin ligase complex Carvalho P, et al. (2006) Distinct ubiquitin-ligase complexes define convergent pathways for the degradation of ER proteins. Cell 126(2):361-73        IDA : Inferred from Direct Assay Assigned on 2008-02-06 SGD endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9        IDA : Inferred from Direct Assay Assigned on 2002-07-15 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9904 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-29 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forCUE1/YMR264W for CUE1 1) Kopski KM and Huffaker TC (1997) Suppressors of the ndc10-2 mutation: a role for the ubiquitin system in Saccharomyces cerevisiae kinetochore function. Genetics 147(2):409-20      2) Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9        3) Shih SC, et al. (2003) A ubiquitin-binding motif required for intramolecular monoubiquitylation, the CUE domain. EMBO J 22(6):1273-81

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CUE1/YMR264W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CUE1/YMR264W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MEDSRLL C-term DLQSLLT Length(aa) 203 MW(Da) 22,762 pI 6.69 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.060   Codon Adaptation Index 0.125   Frequency of Optimal Codons 0.421   Hydropathicity of Protein -0.584   Aromaticity Score 0.064	10 20 30 40 50 | | | | | MEDSRLLITLILVFGVIFLKKFFQSNQHPSAQRLSATGVNAHGRPQGSTQ NALRRTGRVNGGHPVTTQMVETVQNLAPNLHPEQIRYSLENTGSVEETVE RYLRGDEFSFPPGFEPSRAPMGANAAVDNNAAGGGEFNDPRKKNMICAEN LLDKFHVDLNEDMSNLSFKDLDIEERKRLLVWQARKNLETKLQSDKDLQS LLT*

Protein Structures from PDB: proteins of known structure with sequence similarity to CUE1/YMR264W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CUE1	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
KIS4	Kopski KM and Huffaker TC (1997) Suppressors of the ndc10-2 mutation: a role for the ubiquitin system in Saccharomyces cerevisiae kinetochore function. Genetics 147(2):409-20

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YMR264W	SGD Systematic Sequence
855306	NCBI: Gene ID
NP_013991.1	NCBI: RefSeq protein version ID
NP_013991.1	NCBI: RefSeq protein version ID
6323920	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
39 curated references; 0 references not yet curated
Mutants/Phenotypes Regulatory Role Strains/Constructs	Adle DJ, et al. (2009) Cadmium-mediated rescue from ER-associated degradation induces expression of its exporter. Proc Natl Acad Sci U S A 106(25):10189-94	|CDC48 |HRD1 |PCA1 |SEC23 |SSM4 |UBC6 |UBC7 |YOR1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jonikas MC, et al. (2009) Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum. Science 323(5922):1693-7	|AIM27 |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |DER1 |DIE2 |EMC1 |EMC2 |EMC4 |EMC6 |GET1 |MORE
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Kostova Z, et al. (2009) A Ubc7p-binding domain in Cue1p activates ER-associated protein degradation. J Cell Sci 122(Pt 9):1374-81	|HRD1 |SSM4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Duennwald ML and Lindquist S (2008) Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity. Genes Dev 22(23):3308-3319	|CDC48 |HAC1 |IRE1 |NPL4 |OLE1 |PMR1 |PRC1 |PRE1 |PRE2 |PRE9 |RAD6 |RPN2 |SEC22 |SEC61 |MORE
Mutants/Phenotypes	Li F, et al. (2008) Thiopurine S-methyltransferase pharmacogenetics: autophagy as a mechanism for variant allozyme degradation. Pharmacogenet Genomics 18(12):1083-94	|ADY3 |APE3 |ATG10 |ATG12 |ATG3 |ATG5 |ATG7 |ATG8 |BUD14 |CNE1 |CPS1 |ERP1 |ERP2 |ERV46 |MORE
Function/Process Mutants/Phenotypes Substrates/Ligands/Cofactors	Metzger MB, et al. (2008) Degradation of a Cytosolic Protein Requires Endoplasmic Reticulum-associated Degradation Machinery. J Biol Chem 283(47):32302-16	|CDC48 |HLJ1 |NPL4 |SSA1 |SSM4 |UBC4 |UBC5 |UBC6 |UBC7 |UFD1 |URA3 |YDJ1
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Genetic Interactions Mutants/Phenotypes	Mazon MJ, et al. (2007) Efficient degradation of misfolded mutant Pma1 by endoplasmic reticulum-associated degradation requires Atg19 and the Cvt/autophagy pathway. Mol Microbiol 63(4):1069-1077	|ATG19 |DER1 |HRD1 |HRD3 |NPL4 |PEP4 |PMA1 |PRE1 |PRE2 |UBC7
Protein-protein Interactions	Ng W, et al. (2007) Characterization of the proteasome interaction with the Sec61 channel in the endoplasmic reticulum. J Cell Sci 120(Pt 4):682-91	|CDC48 |HRD1 |KAR2 |RPT1 |RPT3 |RPT5 |RPT6 |SBH1 |SEC61 |SEC62 |SEC63 |SEC72 |SSH1 |SSM4 |MORE
Protein-protein Interactions	Ravid T and Hochstrasser M (2007) Autoregulation of an E2 enzyme by ubiquitin-chain assembly on its catalytic residue. Nat Cell Biol 9(4):422-7	|UBC7 |UFD4
Mutants/Phenotypes Strains/Constructs	Apodaca J, et al. (2006) Cellular tolerance of prion protein PrP in yeast involves proteolysis and the unfolded protein response. Biochem Biophys Res Commun 347(1):319-26	|DER1 |HRD1 |HRD3 |IRE1 |KAR2 |SSM4
Reviews	Boyce M and Yuan J (2006) Cellular response to endoplasmic reticulum stress: a matter of life or death. Cell Death Differ 13(3):363-73	|CDC48 |DER1 |GCN2 |GCN4 |HAC1 |HRD1 |HRD3 |IRE1 |KAR2 |PDI1 |SEC61 |UBC1 |UBC6 |UBC7
Protein-protein Interactions	Carvalho P, et al. (2006) Distinct ubiquitin-ligase complexes define convergent pathways for the degradation of ER proteins. Cell 126(2):361-73	|CDC48 |DER1 |HRD1 |HRD3 |IRE1 |NPL4 |SSM4 |UBC7 |UBX2 |USA1 |YOS9
Function/Process Mutants/Phenotypes Strains/Constructs	Liao M, et al. (2006) Endoplasmic reticulum-associated degradation of cytochrome P450 CYP3A4 in Saccharomyces cerevisiae: further characterization of cellular participants and structural determinants. Mol Pharmacol 69(6):1897-904	|CDC48 |HRD1 |HRD3 |NPL4 |PEP4 |RPN1 |RSP5 |SSM4 |UBC6 |UBC7 |UFD1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Loertscher J, et al. (2006) Endoplasmic reticulum-associated degradation is required for cold adaptation and regulation of sterol biosynthesis in the yeast Saccharomyces cerevisiae. Eukaryot Cell 5(4):712-22	|HMG1 |HMG2 |PRE1 |PRE2 |SSM4 |UBC7
Genetic Interactions	Ravid T, et al. (2006) Membrane and soluble substrates of the Doa10 ubiquitin ligase are degraded by distinct pathways. EMBO J 25(3):533-43	|CBF2 |CDC48 |MATALPHA2 |MPS2 |NPL4 |QRI1 |SSM4 |UBC6 |UFD1
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes	Kim W, et al. (2005) Yos9p detects and targets misfolded glycoproteins for ER-associated degradation. Mol Cell 19(6):753-64	|DER1 |MNL1 |YOS9
Reviews	Kenichiro F and Hidehito T (2004) [Structural biology of ubiquitin and ubiquitin binding domain/motif] Tanpakushitsu Kakusan Koso 49(7 Suppl):1042-3	|RPN10
Genetic Interactions Strains/Constructs	Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9	|ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Function/Process Fungal Related Genes/Proteins Protein Sequence Features	Donaldson KM, et al. (2003) Ubiquitin signals protein trafficking via interaction with a novel ubiquitin binding domain in the membrane fusion regulator, Vps9p. Curr Biol 13(3):258-62	|UBI4 |VPS9
Function/Process Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Substrates/Ligands/Cofactors	Kang RS, et al. (2003) Solution structure of a CUE-ubiquitin complex reveals a conserved mode of ubiquitin binding. Cell 113(5):621-30	|CUE2
Reviews	Lima CD (2003) CUE'd up for Monoubiquitin. Cell 113(5):554-6
Reviews	Schnell JD and Hicke L (2003) Non-traditional functions of ubiquitin and ubiquitin-binding proteins. J Biol Chem 278(38):35857-60	|CDC48 |MMS2 |NPL4 |RPN10 |RSP5 |STP2 |UBI4 |UFD1
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Shih SC, et al. (2003) A ubiquitin-binding motif required for intramolecular monoubiquitylation, the CUE domain. EMBO J 22(6):1273-81	|CUE2 |CUE3 |CUE4 |CUE5 |RSP5 |VPS9
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Mutants/Phenotypes Strains/Constructs	Spear ED and Ng DT (2003) Stress tolerance of misfolded carboxypeptidase Y requires maintenance of protein trafficking and degradative pathways. Mol Biol Cell 14(7):2756-67	|BST1 |CPS1 |DER1 |ERV29 |GAS1 |HRD1 |IRE1 |PEP4 |PRC1
Mutants/Phenotypes Protein Sequence Features	Waizenegger T, et al. (2003) Signal-anchor domains of proteins of the outer membrane of mitochondria: structural and functional characteristics. J Biol Chem 278(43):42064-71	|OM45 |TOM20 |TOM70
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes	McBratney S and Winey M (2002) Mutant membrane protein of the budding yeast spindle pole body is targeted to the endoplasmic reticulum degradation pathway. Genetics 162(2):567-78	|HRD1 |MPS2 |NDC1 |UBC6 |UBC7
Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Gardner RG, et al. (2001) In vivo action of the HRD ubiquitin ligase complex: mechanisms of endoplasmic reticulum quality control and sterol regulation. Mol Cell Biol 21(13):4276-91	|HMG1 |HMG2 |HRD1 |HRD3 |RPN1 |UBC7
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Walter J, et al. (2001) Sec61p-independent degradation of the tail-anchored ER membrane protein Ubc6p. EMBO J 20(12):3124-31	|DER1 |HRD1 |HRD3 |SEC61 |UBC1 |UBC6 |UBC7
Function/Process Mutants/Phenotypes RNA Levels and Processing Strains/Constructs	Friedlander R, et al. (2000) A regulatory link between ER-associated protein degradation and the unfolded-protein response. Nat Cell Biol 2(7):379-84	|HAC1 |HRD1 |IRE1 |PRC1 |UBC1 |UBC7
Cellular Location Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors	Gilon T, et al. (2000) Degradation signals recognized by the Ubc6p-Ubc7p ubiquitin-conjugating enzyme pair. Mol Cell Biol 20(19):7214-9	|HRD1 |SEC61 |UBC6 |UBC7
Function/Process Mutants/Phenotypes Strains/Constructs	Lenk U and Sommer T (2000) Ubiquitin-mediated proteolysis of a short-lived regulatory protein depends on its cellular localization. J Biol Chem 275(50):39403-10	|MATALPHA2 |UBC6 |UBC7
Protein Sequence Features	Ponting CP (2000) Proteins of the endoplasmic-reticulum-associated degradation pathway: domain detection and function prediction. Biochem J 351 Pt 2():527-35	|BRR2 |HRD3 |IRE1 |SEC63 |SEC72 |VPS9
DNA/RNA Sequence Features Function/Process Protein Physical Properties Protein Sequence Features Regulatory Role Strains/Constructs	Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9	|SEC61 |UBC6 |UBC7
Genetic Interactions	Kopski KM and Huffaker TC (1997) Suppressors of the ndc10-2 mutation: a role for the ubiquitin system in Saccharomyces cerevisiae kinetochore function. Genetics 147(2):409-20	|CBF2 |CDC34 |SSM4 |UBC6 |UBC7
Reviews	Riezman H (1997) The ins and outs of protein translocation. Science 278(5344):1728-9	|KAR2 |SEC61 |SEC63 |UBC6 |UBC7
Function/Process	Sommer T and Wolf DH (1997) Endoplasmic reticulum degradation: reverse protein flow of no return. FASEB J 11(14):1227-33	|DER1 |HRD1 |HRD3 |KAR2 |SEC61 |SEC63 |UBC6 |UBC7

Return to SGD

Send a Message to the SGD Curators