SCJ1/YMR214W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 695349 to 696482
CDS: 695349 - 696482

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SCJ1 YMR214W ORF, Verified S000004827

Description
One of several homologs of bacterial chaperone DnaJ, located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
chaperone binding Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2004-07-23 SGD
heat shock protein binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001305 , EBI:IPR001623 , EBI:IPR003095 , EBI:IPR018253
Assigned on 2007-05-23 UniProtKB
metal ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0479
Assigned on 2007-05-23 UniProtKB
unfolded protein binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001305 , EBI:IPR002939 , EBI:IPR003095 , EBI:IPR008971
Assigned on 2007-05-23 UniProtKB
Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
             RCA : Reviewed Computational Analysis
Assigned on 2009-09-03 YeastFunc
zinc ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0862
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER-associated protein catabolic process Nishikawa SI, et al. (2001) Molecular chaperones in the yeast endoplasmic reticulum maintain the solubility of proteins for retrotranslocation and degradation. J Cell Biol 153(5):1061-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-02-01 SGD
cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       RCA : Reviewed Computational Analysis
Assigned on 2009-03-03 SGD
protein folding Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-26 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001305 , EBI:IPR002939 , EBI:IPR003095 , EBI:IPR008971
Assigned on 2008-02-13 UniProtKB
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
response to unfolded protein Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-11-19 SGD
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2009-10-01 UniProtKB
endoplasmic reticulum lumen Schlenstedt G, et al. (1995) A yeast DnaJ homologue, Scj1p, can function in the endoplasmic reticulum with BiP/Kar2p via a conserved domain that specifies interactions with Hsp70s. J Cell Biol 129(4):979-88
     IDA : Inferred from Direct Assay
Assigned on 2002-09-26 SGD
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0096
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for SCJ1/YMR214W for SCJ1
Hsp40/DnaJ is a family of proteins, established by bacterial DnaJ, that regulates Hsp70 chaperone activity. Hsp40s stimulate the intrinsically weak ATPase activity of Hsp70 proteins and facilitate Hsp70 interaction with polypeptide substrates. Hsp70 family members often have multiple Hsp40 partners, and these specific pairings govern Hsp70 chaperone involvement in particular processes (reviewed in 1, 2, and 3). All Hsp40s contain a highly conserved 75-amino acid J domain, which interacts with the ATPase domain of Hsp70 to stimulate ATP hydrolysis. However, there are also other conserved structural domains, and based on the presence or absence of these regions, the Hsp40 family can be divided into three subtypes: type I, type II and type III (a comprehensive overview of the structural features of the different HSP40 subtypes can be found in 3). Sequence analysis of the S. cerevisiae genome has revealed 22 proteins in the Hsp40/DnaJ family: YDJ1, XDJ1, APJ1, SIS1, DJP1, ZUO1, SWA2, JJJ1, JJJ2, JJJ3, CAJ1, CWC23, MDJ1, MDJ2, PAM18, JAC1, JID1, SCJ1, HLJ1, JEM1, SEC63, and ERJ5 (3).
Last Updated: 2006-12-19

Basic References [TOP]
BASIC INFORMATION REFERENCES forSCJ1/YMR214W for SCJ1
1) Qiu XB, et al. (2006) The diversity of the DnaJ/Hsp40 family, the crucial partners for Hsp70 chaperones. Cell Mol Life Sci 63(22):2560-2570

2) Cyr DM, et al. (1994) DnaJ-like proteins: molecular chaperones and specific regulators of Hsp70. Trends Biochem Sci 19(4):176-81

3) Walsh P, et al. (2004) The J-protein family: modulating protein assembly, disassembly and translocation. EMBO Rep 5(6):567-71

4) Blumberg H and Silver PA (1991) A homologue of the bacterial heat-shock gene DnaJ that alters protein sorting in yeast. Nature 349(6310):627-30

5) Schlenstedt G, et al. (1995) A yeast DnaJ homologue, Scj1p, can function in the endoplasmic reticulum with BiP/Kar2p via a conserved domain that specifies interactions with Hsp70s. J Cell Biol 129(4):979-88

6) Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SCJ1/YMR214W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SCJ1/YMR214W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MIPKLYI

C-term NMLKDEL

Length(aa) 377

MW(Da) 41,543

pI 7.41

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.174

Codon Adaptation Index 0.159

Frequency of Optimal Codons 0.507

Hydropathicity of Protein -0.528

Aromaticity Score 0.085

10 20 30 40 50 | | | | | MIPKLYIHLILSLLLLPLILAQDYYAILEIDKDATEKEIKSAYRQLSKKY HPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGG PGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPMIKVQEKLSL KQFYSGSSIEFTLNLNDECDACHGSGSADGKLAQCPDCQGRGVIIQVLRM GIMTQQIQQMCGRCGGTGQIIKNECKTCHGKKVTKKNKFFHVDVPPGAPR NYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSA AEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG YGDLYIDYVVVMPKTFKSGQNMLKDEL*

Protein Structures from PDB: proteins of known structure with sequence similarity to SCJ1/YMR214W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to SCJ1 Homolog Source (per PDB) Protein Alignment: SCJ1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1nlt ( Chain: A)
The crystal structure of hsp40 ydj1
PDB_Info
PDB_Structure
Saccharomyces cerevisiae 8.3e-24 34 29 View alignment SCOP
MMDB
CATH
1xbl ( Chain: A)
Nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
PDB_Info
PDB_Structure
Escherichia coli 7.4e-18 52 22 View alignment SCOP
MMDB
CATH
1bq0 ( Chain: A)
J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
PDB_Info
PDB_Structure
Escherichia coli 9.2e-17 52 22 View alignment SCOP
MMDB
CATH
2o37 ( Chain: A)
J-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae.
PDB_Info
PDB_Structure
Saccharomyces cerevisiae 2.4e-13 49 33 View alignment SCOP
MMDB
CATH
1bqz ( Chain: A)
J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
PDB_Info
PDB_Structure
Escherichia coli 9.5e-13 53 27 View alignment SCOP
MMDB
CATH
2dmx ( Chain: A)
Solution structure of the j domain of dnaj homolog subfamily b member 8
PDB_Info
PDB_Structure
Homo sapiens 3.9e-11 48 33 View alignment SCOP
MMDB
CATH
1hdj ( Chain: A)
Human hsp40 (hdj-1), nmr
PDB_Info
PDB_Structure
Homo sapiens 1.3e-10 48 32 View alignment SCOP
MMDB
CATH
2dn9 ( Chain: A)
Solution structure of j-domain from the dnaj homolog, human tid1 protein
PDB_Info
PDB_Structure
Homo sapiens 3.0e-10 54 27 View alignment SCOP
MMDB
CATH
2ctr ( Chain: A)
Solution structure of j-domain from human dnaj subfamily b menber 9
PDB_Info
PDB_Structure
Homo sapiens 3.4e-10 49 29 View alignment SCOP
MMDB
CATH
2ej7 ( Chain: A)
Solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21
PDB_Info
PDB_Structure
Homo sapiens 1.6e-09 50 35 View alignment SCOP
MMDB
CATH
2ctp ( Chain: A)
Solution structure of j-domain from human dnaj subfamily b menber 12
PDB_Info
PDB_Structure
Homo sapiens 5.2e-09 52 25 View alignment SCOP
MMDB
CATH
1exk ( Chain: A)
Solution structure of the cysteine-rich domain of the escherichia coli chaperone protein dnaj.
PDB_Info
PDB_Structure
Escherichia coli 1.2e-08 42 24 View alignment SCOP
MMDB
CATH
2ctw ( Chain: A)
Solution structure of j-domain from mouse dnaj subfamily c menber 5
PDB_Info
PDB_Structure
Mus musculus 2.2e-08 46 33 View alignment SCOP
MMDB
CATH
2och ( Chain: A)
J-domain of dnj-12 from caenorhabditis elegans
PDB_Info
PDB_Structure
Caenorhabditis elegans 8.5e-08 41 33 View alignment SCOP
MMDB
CATH
2ctt ( Chain: A)
Solution structure of zinc finger domain from human dnaj subfamily a menber 3
PDB_Info
PDB_Structure
Homo sapiens 1.8e-07 34 33 View alignment SCOP
MMDB
CATH
2cug ( Chain: A)
Solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962
PDB_Info
PDB_Structure
Mus musculus 1.2e-06 39 43 View alignment SCOP
MMDB
CATH
1wjz ( Chain: A)
Soluiotn structure of j-domain of mouse dnaj like protein
PDB_Info
PDB_Structure
Mus musculus 2.6e-05 41 25 View alignment SCOP
MMDB
CATH
2yua ( Chain: A)
Solution structure of the dnaj domain from human williams- beuren syndrome chromosome region 18 protein
PDB_Info
PDB_Structure
Homo sapiens 7.0e-05 36 30 View alignment SCOP
MMDB
CATH
2qsa ( Chain: A)
Crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans.
PDB_Info
PDB_Structure
Caenorhabditis elegans 0.001200 34 37 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SCJ1 Blumberg H and Silver PA (1991) A homologue of the bacterial heat-shock gene DnaJ that alters protein sorting in yeast. Nature 349(6310):627-30

Sequence Annotation Notes
Date Note
2003-09-22 Based on the automated comparison of closely related Saccharomyces species, Kellis et al. suggest that the start site for SCJ1/YMR214W be moved 81 nt (27 codons) downstream. This suggestion was reviewed and accepted by SGD curators. The numbering for both the nucleotides in the DNA coding sequence and the amino acids in the predicted protein have been changed accordingly. Evidence supporting this change includes: 1) This is the predicted start methionine in the majority of Saccharomyces species orthologs analyzed by Kellis et al. and/or Cliften et al.; 2) Significant sequence conservation begins abruptly at this predicted start methionine; 3) Insertions and deletions in S. paradoxus, S. mikatae and S. bayanus relative to the S. cerevisiae sequence create frameshifts between the upstream and downstream ATGs; 4) Mori et al. demonstrate that a beta-galactosidase fusion is expressed when fused immediately downstream of Met28, but not when fused downstream of Met1; 5) an NCBI BLAST against the non-redundant dataset shows that there are many DnaJ-related proteins from various species with strong sequence similarity to SCJ1 beginning around amino acid 50 (C-terminal to the predicted Met28), with no strong similarity before amino acid 50.
Mori K, et al. (1998) Palindrome with spacer of one nucleotide is characteristic of the cis-acting unfolded protein response element in Saccharomyces cerevisiae. J Biol Chem 273(16):9912-20

Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54

Cliften P, et al. (2003) Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6

Standard Name	Reference
SCJ1	Blumberg H and Silver PA (1991) A homologue of the bacterial heat-shock gene DnaJ that alters protein sorting in yeast. Nature 349(6310):627-30

Date	Note
2003-09-22	Based on the automated comparison of closely related Saccharomyces species, Kellis et al. suggest that the start site for SCJ1/YMR214W be moved 81 nt (27 codons) downstream. This suggestion was reviewed and accepted by SGD curators. The numbering for both the nucleotides in the DNA coding sequence and the amino acids in the predicted protein have been changed accordingly. Evidence supporting this change includes: 1) This is the predicted start methionine in the majority of Saccharomyces species orthologs analyzed by Kellis et al. and/or Cliften et al.; 2) Significant sequence conservation begins abruptly at this predicted start methionine; 3) Insertions and deletions in S. paradoxus, S. mikatae and S. bayanus relative to the S. cerevisiae sequence create frameshifts between the upstream and downstream ATGs; 4) Mori et al. demonstrate that a beta-galactosidase fusion is expressed when fused immediately downstream of Met28, but not when fused downstream of Met1; 5) an NCBI BLAST against the non-redundant dataset shows that there are many DnaJ-related proteins from various species with strong sequence similarity to SCJ1 beginning around amino acid 50 (C-terminal to the predicted Met28), with no strong similarity before amino acid 50. *Mori K, et al.* (1998)** Palindrome with spacer of one nucleotide is characteristic of the cis-acting unfolded protein response element in Saccharomyces cerevisiae. J Biol Chem 273(16):9912-20 *Kellis M, et al.* (2003)** Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54 *Cliften P, et al.* (2003)** Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301(5629):71-6

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YMR214W SGD Systematic Sequence

855254 NCBI: Gene ID

NP_013941.2 NCBI: RefSeq protein version ID

NP_013941.2 NCBI: RefSeq protein version ID

37362683 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YMR214W	SGD Systematic Sequence
855254	NCBI: Gene ID
NP_013941.2	NCBI: RefSeq protein version ID
NP_013941.2	NCBI: RefSeq protein version ID
37362683	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
30 curated references; 1 references not yet curated
Not yet curated Buck TM, et al. (2010) The ER Associated Degradation of the Epithelial Sodium Channel Requires a Unique Complement of Molecular Chaperones. Mol Biol Cell
       |JEM1
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Gong Y, et al. (2009) An atlas of chaperone-protein interactions in Saccharomyces cerevisiae: implications to protein folding pathways in the cell. Mol Syst Biol 5:275
       |APJ1 |CAJ1 |CWC23 |DJP1 |ECM10 |ERJ5 |GIM3 |GIM4 |GIM5 |HLJ1 |HSC82 |HSP104 |HSP12 |HSP26 |MORE
Genetic Interactions
Kim JH, et al. (2009) The unfolded protein response is necessary but not sufficient to compensate for defects in disulfide isomerization. J Biol Chem 284(16):10400-8
         |ALG8 |APM3 |APS3 |ARL1 |AVL9 |CCZ1 |CDC50 |COG8 |EPS1 |ERV41 |ERV46 |EUG1 |FLD1 |GCS1 |MORE
RNA Levels and Processing
Regulation of
Molin C, et al. (2009) mRNA stability changes precede changes in steady-state mRNA amounts during hyperosmotic stress. RNA 15(4):600-14
       |AGP2 |AHP1 |ALD3 |ARP8 |BMH1 |COS8 |DAK1 |DOA1 |EAF3 |ENA1 |GLC7 |GLK1 |GLO1 |GPD1 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Vembar SS, et al. (2009) The Mammalian Hsp40 ERdj3 Requires Its Hsp70 Interaction and Substrate-binding Properties to Complement Various Yeast Hsp40-dependent Functions. J Biol Chem 284(47):32462-71
       |HLJ1 |JEM1 |YDJ1
Mutants/Phenotypes
Makio T, et al. (2008) Identification and characterization of a Jem1p ortholog of Candida albicans: dissection of Jem1p functions in karyogamy and protein quality control in Saccharomyces cerevisiae. Genes Cells 13(10):1015-26
       |JEM1 |KAR2 |MPS3
Genetic Interactions
Mutants/Phenotypes
RNA Levels and Processing
Regulation of
Strains/Constructs
Payne T, et al. (2008) Modulation of Chaperone Gene Expression in Mutagenized Saccharomyces cerevisiae Strains Developed for Recombinant Human Albumin Production Results in Increased Production of Multiple Heterologous Proteins. Appl Environ Microbiol 74(24):7759-66
       |HAC1 |JEM1 |LHS1 |SIL1
Regulation of
Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       |ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Cross-species Expression
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Yamamoto M, et al. (2008) Arabidopsis thaliana has a set of J proteins in the endoplasmic reticulum that are conserved from yeast to animals and plants. Plant Cell Physiol 49(10):1547-62
       |JEM1 |SEC63
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Carla Fama M, et al. (2007) The Saccharomyces cerevisiae YFR041C/ERJ5 gene encoding a type I membrane protein with a J domain is required to preserve the folding capacity of the endoplasmic reticulum. Biochim Biophys Acta 1773(2):232-42
       |ERJ5 |IRE1 |JEM1 |KAR2
Fungal Related Genes/Proteins
Reviews
Burnie JP, et al. (2006) Fungal heat-shock proteins in human disease. FEMS Microbiol Rev 30(1):53-88
     |DJP1 |HSC82 |HSF1 |HSP10 |HSP104 |HSP12 |HSP26 |HSP30 |HSP60 |HSP78 |HSP82 |JAC1 |JEM1 |MDJ1 |MORE
Non-Fungal Related Genes/Proteins
Cajo GC, et al. (2006) The role of the DIF motif of the DnaJ (Hsp40) co-chaperone in the regulation of the DnaK (Hsp70) chaperone cycle. J Biol Chem 281(18):12436-44
       |MDJ1 |YDJ1
Genetic Interactions
Mutants/Phenotypes
Heiligenstein S, et al. (2006) Retrotranslocation of a viral A/B toxin from the yeast endoplasmic reticulum is independent of ubiquitination and ERAD. EMBO J 25(20):4717-27
       |CDC48 |DSK2 |HRD1 |JEM1 |KAR2 |NPL4 |PDI1 |PMR1 |RAD23 |RSP5 |SPF1 |UBC1 |UBC4 |UBC6 |MORE
Genetic Interactions
Takeuchi M, et al. (2006) Saccharomyces cerevisiae Rot1p is an ER-localized membrane protein that may function with BiP/Kar2p in protein folding. J Biochem 139(3):597-605
         |CNE1 |KAR2 |LHS1 |ROT1
Non-Fungal Related Genes/Proteins
Bies C, et al. (2004) Characterization of pancreatic ERj3p, a homolog of yeast DnaJ-like protein Scj1p. Biol Chem 385(5):389-95

Fungal Related Genes/Proteins
Protein Sequence Features
Burri L, et al. (2004) Zim17, a novel zinc finger protein essential for protein import into mitochondria. J Biol Chem 279(48):50243-9
       |APJ1 |HUA1 |MDJ1 |PAM18 |SSC1 |TIM23 |TIM44 |XDJ1 |YDJ1 |ZIM17
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Reviews
Walsh P, et al. (2004) The J-protein family: modulating protein assembly, disassembly and translocation. EMBO Rep 5(6):567-71
       |APJ1 |CAJ1 |CWC23 |DJP1 |ERJ5 |HLJ1 |JAC1 |JEM1 |JID1 |JJJ1 |JJJ2 |JJJ3 |JLP1 |JLP2 |MORE
DNA/RNA Sequence Features
Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54
           |AAT2 |API2 |ASA1 |ASR1 |ATG4 |AUA1 |AVT5 |BLM10 |BUD19 |CAT5 |CBS1 |CIN8 |COG2 |COQ3 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Nishikawa SI, et al. (2001) Molecular chaperones in the yeast endoplasmic reticulum maintain the solubility of proteins for retrotranslocation and degradation. J Cell Biol 153(5):1061-70
       |JEM1 |KAR2 |SEC61 |SEC63
Function/Process
Genetic Interactions
Non-Fungal Related Genes/Proteins
Strains/Constructs
Lisse T and Schwarz E (2000) Functional specificity of the mitochondrial DnaJ protein, Mdj1p, in Saccharomyces cerevisiae. Mol Gen Genet 263(3):527-34
     |MDJ1 |SIS1 |XDJ1 |YDJ1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Brizzio V, et al. (1999) Genetic interactions between KAR7/SEC71, KAR8/JEM1, KAR5, and KAR2 during nuclear fusion in Saccharomyces cerevisiae. Mol Biol Cell 10(3):609-26
       |JEM1 |KAR2 |KAR5 |SEC61 |SEC63 |SEC66 |SEC72
DNA/RNA Sequence Features
Regulation of
Transcription
Mori K, et al. (1998) Palindrome with spacer of one nucleotide is characteristic of the cis-acting unfolded protein response element in Saccharomyces cerevisiae. J Biol Chem 273(16):9912-20
       |EUG1 |FPR2 |HAC1 |KAR2 |LHS1 |PDI1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33
       |JEM1 |KAR2 |OST1 |OST3 |SEC63
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Nishikawa S and Endo T (1997) The yeast JEM1p is a DnaJ-like protein of the endoplasmic reticulum membrane required for nuclear fusion. J Biol Chem 272(20):12889-92
       |JEM1 |KAR2
Genetic Interactions
Regulatory Role
Hamilton TG and Flynn GC (1996) Cer1p, a novel Hsp70-related protein required for posttranslational endoplasmic reticulum translocation in yeast. J Biol Chem 271(48):30610-3
       |KAR2 |LHS1
Non-Fungal Related Genes/Proteins
Kurzik-Dumke U, et al. (1995) Tumor suppression in Drosophila is causally related to the function of the lethal(2) tumorous imaginal discs gene, a dnaJ homolog. Dev Genet 16(1):64-76
     |SEC63 |YDJ1
Cellular Location
Function/Process
Protein Sequence Features
Protein-protein Interactions
Schlenstedt G, et al. (1995) A yeast DnaJ homologue, Scj1p, can function in the endoplasmic reticulum with BiP/Kar2p via a conserved domain that specifies interactions with Hsp70s. J Cell Biol 129(4):979-88
     |KAR2 |MDJ1 |SEC61 |SEC62 |SEC63 |SEC66 |SIS1 |SSC1
Non-Fungal Related Genes/Proteins
Zhu JK, et al. (1993) Expression of an Atriplex nummularia gene encoding a protein homologous to the bacterial molecular chaperone DnaJ. Plant Cell 5(3):341-9
     |SEC63 |SSA1 |SSA2 |SSA3 |SSA4 |YDJ1
Fungal Related Genes/Proteins
Atencio DP and Yaffe MP (1992) MAS5, a yeast homolog of DnaJ involved in mitochondrial protein import. Mol Cell Biol 12(1):283-91
     |YDJ1
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Regulatory Role
Strains/Constructs
Blumberg H and Silver PA (1991) A homologue of the bacterial heat-shock gene DnaJ that alters protein sorting in yeast. Nature 349(6310):627-30

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.