VTI1/YMR197C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 659197 to 658544
CDS: 659197 - 658544

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

VTI1 YMR197C ORF, Verified S000004810

Description
Protein involved in cis-Golgi membrane traffic; v-SNARE that interacts with two t-SNARES, Sed5p and Pep12p; required for multiple vacuolar sorting pathways

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
SNAP receptor activity Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
Golgi to vacuole transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
autophagy Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
intra-Golgi vesicle-mediated transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
intracellular protein transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007705
Assigned on 2007-05-23 UniProtKB
late endosome to vacuole transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
membrane fusion Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
organelle fusion Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle fusion Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
integral to Golgi membrane Lupashin VV, et al. (1997) Characterization of a novel yeast SNARE protein implicated in Golgi retrograde traffic. Mol Biol Cell 8(12):2659-76
       IDA : Inferred from Direct Assay
Assigned on 2002-09-17 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9908
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007705
Assigned on 2008-02-13 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forVTI1/YMR197C for VTI1
1) Lupashin VV, et al. (1997) Characterization of a novel yeast SNARE protein implicated in Golgi retrograde traffic. Mol Biol Cell 8(12):2659-76

2) von Mollard GF, et al. (1997) The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. J Cell Biol 137(7):1511-24

3) Fischer von Mollard G and Stevens TH (1999) The Saccharomyces cerevisiae v-SNARE Vti1p is required for multiple membrane transport pathways to the vacuole. Mol Biol Cell 10(6):1719-32

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for VTI1/YMR197C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for VTI1/YMR197C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSSLLIS

C-term VLFSKFK

Length(aa) 217

MW(Da) 24,668

pI 6.58

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.029

Codon Adaptation Index 0.110

Frequency of Optimal Codons 0.379

Hydropathicity of Protein -0.467

Aromaticity Score 0.055

10 20 30 40 50 | | | | | MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFD LLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDR DRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQ IMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAI IAVLILLILLVLFSKFK*

Protein Structures from PDB: proteins of known structure with sequence similarity to VTI1/YMR197C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to VTI1 Homolog Source (per PDB) Protein Alignment: VTI1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2nps ( Chain: C)
Crystal structure of the early endosomal snare complex
PDB_Info
PDB_Structure
Mus musculus | Rattus norvegicus 3.8e-05 37 32 View alignment SCOP
MMDB
CATH
1vcs ( Chain: A)
Solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
PDB_Info
PDB_Structure
Mus musculus 0.002299 32 33 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
VTI1 von Mollard GF, et al. (1997) The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. J Cell Biol 137(7):1511-24

Standard Name	Reference
VTI1	*von Mollard GF, et al.* (1997)** The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. J Cell Biol 137(7):1511-24

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YMR197C SGD Systematic Sequence

855237 NCBI: Gene ID

NP_013924.1 NCBI: RefSeq protein version ID

NP_013924.1 NCBI: RefSeq protein version ID

6323853 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YMR197C	SGD Systematic Sequence
855237	NCBI: Gene ID
NP_013924.1	NCBI: RefSeq protein version ID
NP_013924.1	NCBI: RefSeq protein version ID
6323853	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
68 curated references; 0 references not yet curated
Strains/Constructs
Hickey CM, et al. (2009) The Major Role of the Rab Ypt7p in Vacuole Fusion Is Supporting HOPS Membrane Association. J Biol Chem 284(24):16118-25
       |GYP1 |NYV1 |PEP3 |PEP5 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41 |YCK3 |YPT7
Computational analysis
Evolution
Fungal Related Genes/Proteins
Kienle N, et al. (2009) Phylogeny of the SNARE vesicle fusion machinery yields insights into the conservation of the secretory pathway in fungi. BMC Evol Biol 9:19
       |BET1 |BOS1 |NYV1 |PEP12 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SRO7 |SRO77 |SSO1 |MORE
Protein Sequence Features
Krishnankutty RK, et al. (2009) Proteolytic processing of certain CaaX motifs can occur in the absence of the Rce1p and Ste24p CaaX proteases. Yeast 26(8):451-63
       |AXL1 |MFA1 |MOH1 |MRPS8 |NAP1 |PEX19 |POP8 |RCE1 |REC1 |SAM37 |STE14 |STE23 |STE24 |VPS71 |MORE
Function/Process
Mima J and Wickner W (2009) Complex lipid requirements for SNARE- and SNARE chaperone-dependent membrane fusion. J Biol Chem 284(40):27114-22
       |NYV1 |SEC17 |SEC18 |VAM3 |VPS33
Function/Process
Mima J and Wickner W (2009) Phosphoinositides and SNARE chaperones synergistically assemble and remodel SNARE complexes for membrane fusion. Proc Natl Acad Sci U S A 106(38):16191-6
       |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41
Reviews
Saito C and Ueda T (2009) Chapter 4 Functions of RAB and SNARE Proteins in Plant Life. Int Rev Cell Mol Biol 274:183-233
       |MSO1 |PEP12 |PEP3 |PEP5 |PEP7 |SAR1 |SEC1 |SEC2 |SEC20 |SEC4 |SEC9 |SFT1 |SNC1 |SSO1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Stein IS, et al. (2009) TVP23 interacts genetically with the yeast SNARE VTI1 and functions in retrograde transport from the early endosome to the late Golgi. Biochem J 419(1):229-36
       |TVP23
Function/Process
Stroupe C, et al. (2009) From the Cover: Feature Article: Minimal membrane docking requirements revealed by reconstitution of Rab GTPase-dependent membrane fusion from purified components. Proc Natl Acad Sci U S A 106(42):17626-33
       |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41 |YPT7
Cellular Location
Wiederhold E, et al. (2009) The yeast vacuolar membrane proteome. Mol Cell Proteomics 8(2):380-92
       |ADP1 |AKR2 |APE3 |APL5 |APM3 |AVT1 |AVT3 |AVT7 |CPS1 |DAP2 |ECM14 |ENO2 |FMP42 |FRE6 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Function/Process
Substrates/Ligands/Cofactors
Mima J, et al. (2008) Reconstituted membrane fusion requires regulatory lipids, SNAREs and synergistic SNARE chaperones. EMBO J 27(15):2031-42
       |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41 |YPT7
Reviews
Ostrowicz CW, et al. (2008) Yeast vacuole fusion: a model system for eukaryotic endomembrane dynamics. Autophagy 4(1):5-19
       |BEM1 |CCZ1 |CDC42 |CLN3 |CMD1 |GLC7 |LAP4 |MEH1 |MON1 |NYV1 |PEP1 |PEP3 |PEP4 |PEP5 |MORE
Function/Process
Starai VJ, et al. (2008) HOPS Proofreads the trans-SNARE Complex for Yeast Vacuole Fusion. Mol Biol Cell 19(6):2500-8
       |NYV1 |PEP3 |PEP5 |SEC17 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41
Protein-protein Interactions
Kama R, et al. (2007) Btn2, a hook1 ortholog and potential batten disease-related protein, mediates late endosome-Golgi protein sorting in yeast. Mol Cell Biol 27(2):605-21
       |BTN2 |FUR4 |PEP1 |PEP8 |RHB1 |SEC7 |SED5 |SNC1 |SNC2 |SNX4 |STE2 |TLG1 |TLG2 |VPS27 |MORE
Fungal Related Genes/Proteins
Kuratsu M, et al. (2007) Systematic analysis of SNARE localization in the filamentous fungus Aspergillus oryzae. Fungal Genet Biol 44(12):1310-23
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |MORE
Function/Process
Starai VJ, et al. (2007) Excess vacuolar SNAREs drive lysis and Rab bypass fusion. Proc Natl Acad Sci U S A 104(34):13551-8
       |NYV1 |PEP3 |PEP5 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41 |YPT7
Protein-protein Interactions
Strains/Constructs
Techniques and Reagents
Jun Y, et al. (2006) Reversible, cooperative reactions of yeast vacuole docking. EMBO J 25(22):5260-9
       |ACT1 |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS33 |VPS41 |YPT7
Reviews
Reggiori F (2006) 1 membrane origin for autophagy. Curr Top Dev Biol 74:1-30
       |AMS1 |ATG1 |ATG10 |ATG11 |ATG12 |ATG13 |ATG14 |ATG15 |ATG16 |ATG17 |ATG18 |ATG19 |ATG2 |ATG20 |MORE
Protein Physical Properties
Protein-protein Interactions
Protein/Nucleic Acid Structure
Roy R, et al. (2006) Role of the Vam3p transmembrane segment in homodimerization and SNARE complex formation. Biochemistry 45(24):7654-60
         |NYV1 |VAM3 |VAM7
Reviews
Bowers K and Stevens TH (2005) Protein transport from the late Golgi to the vacuole in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1744(3):438-54
       |APL2 |APL4 |APL5 |APL6 |APM1 |APM3 |APS1 |APS3 |GGA1 |GGA2 |HSE1 |KEX2 |MRL1 |PEP1 |MORE
Cellular Location
Protein-protein Interactions
Strains/Constructs
Collins KM, et al. (2005) Sec17p and HOPS, in distinct SNARE complexes, mediate SNARE complex disruption or assembly for fusion. EMBO J 24(10):1775-86
         |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS16 |VPS3 |VPS33 |VPS41 |YKT6 |YPT7
Cellular Location
Dietrich LE, et al. (2005) ATP-independent control of Vac8 palmitoylation by a SNARE subcomplex on yeast vacuoles. J Biol Chem 280(15):15348-55
       |NYV1 |SEC17 |SEC18 |VAC8 |VAM3 |VAM7 |YKT6
Reviews
Hong W (2005) SNAREs and traffic. Biochim Biophys Acta 1744(2):120-44
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |MORE
Reviews
Klionsky DJ (2005) The molecular machinery of autophagy: unanswered questions. J Cell Sci 118(Pt 1):7-18
       |ATG1 |ATG10 |ATG11 |ATG12 |ATG13 |ATG14 |ATG15 |ATG16 |ATG17 |ATG18 |ATG19 |ATG2 |ATG20 |ATG21 |MORE
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Techniques and Reagents
Paumet F, et al. (2005) Concerted auto-regulation in yeast endosomal t-SNAREs. J Biol Chem 280(22):21137-43
       |PEP12 |TLG1 |TLG2
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Burri L and Lithgow T (2004) A complete set of SNAREs in yeast. Traffic 5(1):45-52
       |BET1 |BOS1 |FRT1 |FRT2 |GOS1 |NYV1 |PEP12 |SEC20 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |MORE
Function/Process
Regulation of
Faergeman NJ, et al. (2004) Acyl-CoA-binding protein, Acb1p, is required for normal vacuole function and ceramide synthesis in Saccharomyces cerevisiae. Biochem J 380(Pt 3):907-18
       |ACB1 |GAS1 |LAP4 |NYV1 |PHO8 |PRC1 |VAM3
Function/Process
Regulatory Role
Merz AJ and Wickner WT (2004) Trans-SNARE interactions elicit Ca2+ efflux from the yeast vacuole lumen. J Cell Biol 164(2):195-206
       |NYV1 |SEC17 |SEC18 |VAM3 |VAM7 |YPT7
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Paumet F, et al. (2004) The specificity of SNARE-dependent fusion is encoded in the SNARE motif. Proc Natl Acad Sci U S A 101(10):3376-80
       |PEP12 |SNC1 |SNC2 |TLG1
Function/Process
Protein-protein Interactions
Thorngren N, et al. (2004) A soluble SNARE drives rapid docking, bypassing ATP and Sec17/18p for vacuole fusion. EMBO J 23(14):2765-76
         |NYV1 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPH1 |VPS33 |VPS41 |YKT6 |YPT7
Cellular Location
Function/Process
Brown CR, et al. (2003) The Vid vesicle to vacuole trafficking event requires components of the SNARE membrane fusion machinery. J Biol Chem 278(28):25688-99
       |FBP1 |NYV1 |PEP4 |PHO8 |VAM3 |VAM6 |VID24 |VPS41 |YKT6 |YPT7
Function/Process
Protein-protein Interactions
Rohde J, et al. (2003) The transmembrane domain of Vam3 affects the composition of cis- and trans-SNARE complexes to promote homotypic vacuole fusion. J Biol Chem 278(3):1656-62
       |NYV1 |SEC18 |VAC8 |VAM3 |YKT6
Non-Fungal Related Genes/Proteins
Surpin M, et al. (2003) The VTI family of SNARE proteins is necessary for plant viability and mediates different protein transport pathways. Plant Cell 15(12):2885-99

Cellular Location
Wang CW, et al. (2003) Yeast homotypic vacuole fusion requires the Ccz1-Mon1 complex during the tethering/docking stage. J Cell Biol 163(5):973-85
       |CCZ1 |MON1 |NYV1 |PEP3 |PEP5 |SEC17 |SEC18 |VAC8 |VAM3 |VAM7 |VPS16 |VPS33 |VPS41 |YPT7
Cellular Location
Techniques and Reagents
Wang L, et al. (2003) Hierarchy of protein assembly at the vertex ring domain for yeast vacuole docking and fusion. J Cell Biol 160(3):365-74
       |ACT1 |GYP1 |NYV1 |SEC17 |SEC18 |VAM3 |VAM6 |VAM7 |VPS33 |YPT7
Non-Fungal Related Genes/Proteins
Kato T, et al. (2002) SGR2, a phospholipase-like protein, and ZIG/SGR4, a SNARE, are involved in the shoot gravitropism of Arabidopsis. Plant Cell 14(1):33-46
           |YOR022C
Function/Process
Protein-protein Interactions
Lewis MJ and Pelham HR (2002) A new yeast endosomal SNARE related to mammalian syntaxin 8. Traffic 3(12):922-9
             |PEP12 |SNC1 |SYN8 |TLG1 |YKT6
Reviews
Xue M and Zhang B (2002) Do SNARE proteins confer specificity for vesicle fusion? Proc Natl Acad Sci U S A 99(21):13359-61
         |PEP12 |SEC22 |SEC9 |VAM3 |YKT6
Function/Process
Protein-protein Interactions
Techniques and Reagents
Brickner JH, et al. (2001) The Tlg SNARE complex is required for TGN homotypic fusion. J Cell Biol 155(6):969-78
       |KEX2 |STE13 |TLG1 |TLG2 |VPS21
Function/Process
Protein-protein Interactions
Bryant NJ and James DE (2001) Vps45p stabilizes the syntaxin homologue Tlg2p and positively regulates SNARE complex formation. EMBO J 20(13):3380-8
       |TLG1 |TLG2 |VPS45
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Dilcher M, et al. (2001) Genetic interactions with the yeast Q-SNARE VTI1 reveal novel functions for the R-SNARE YKT6. J Biol Chem 276(37):34537-44
       |PEP12 |VAM7 |VTS1 |YKT6
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ishihara N, et al. (2001) Autophagosome requires specific early Sec proteins for its formation and NSF/SNARE for vacuolar fusion. Mol Biol Cell 12(11):3690-702
       |SEC12 |SEC13 |SEC16 |SEC18 |SEC23 |SEC24 |SEC31
Function/Process
Techniques and Reagents
Laage R and Ungermann C (2001) The N-terminal domain of the t-SNARE Vam3p coordinates priming and docking in yeast vacuole fusion. Mol Biol Cell 12(11):3375-85
         |VAM3 |VPS33
Function/Process
Protein-protein Interactions
Paumet F, et al. (2001) A t-SNARE of the endocytic pathway must be activated for fusion. J Cell Biol 155(6):961-8
       |SNC1 |SNC2 |TLG1 |TLG2
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Takita Y, et al. (2001) Inhibition of the Ca(2+)-ATPase Pmc1p by the v-SNARE protein Nyv1p. J Biol Chem 276(9):6200-6
       |CCH1 |CRZ1 |MID1 |NYV1 |PMC1 |VAM3 |VCX1 |YKT6
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Tsui MM, et al. (2001) Selective formation of Sed5p-containing SNARE complexes is mediated by combinatorial binding interactions. Mol Biol Cell 12(3):521-38
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC22 |SED5 |SFT1 |SNC2 |TLG1 |VAM3 |VAM7 |YKT6
Function/Process
Protein-protein Interactions
Wang Y, et al. (2001) Functional analysis of conserved structural elements in yeast syntaxin Vam3p. J Biol Chem 276(30):28598-605
       |NYV1 |VAM3 |VAM7 |YKT6
Cellular Location
Function/Process
Protein-protein Interactions
Regulation of
Strains/Constructs
Fukuda R, et al. (2000) Functional architecture of an intracellular membrane t-SNARE. Nature 407(6801):198-202
       |NYV1 |VAM3 |VAM7 |YKT6
Function/Process
Strains/Constructs
McNew JA, et al. (2000) Compartmental specificity of cellular membrane fusion encoded in SNARE proteins. Nature 407(6801):153-9
       |BET1 |BOS1 |NYV1 |SEC22 |SEC9 |SED5 |SNC2 |SSO1 |VAM3 |VAM7
Reviews
Odorizzi G, et al. (2000) Phosphoinositide signaling and the regulation of membrane trafficking in yeast. Trends Biochem Sci 25(5):229-35
       |FAB1 |FIG4 |FRQ1 |INP51 |INP52 |INP53 |INP54 |MSS4 |PEP1 |PEP12 |PEP7 |PIB1 |PIB2 |PIK1 |MORE
Function/Process
Protein-protein Interactions
Sato TK, et al. (2000) Class C Vps protein complex regulates vacuolar SNARE pairing and is required for vesicle docking/fusion. Mol Cell 6(3):661-71
       |PEP3 |PEP5 |VAM3 |VAM7 |VPS16 |VPS33
Function/Process
Protein-protein Interactions
Tsui MM and Banfield DK (2000) Yeast Golgi SNARE interactions are promiscuous. J Cell Sci 113 ( Pt 1)():145-52
       |BET1 |BOS1 |GOS1 |SEC22 |SED5 |SFT1 |YKT6
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Coe JG, et al. (1999) A role for Tlg1p in the transport of proteins within the Golgi apparatus of Saccharomyces cerevisiae. Mol Biol Cell 10(7):2407-23
       |SEC17 |SED5 |TLG1 |TLG2 |VAM3 |VPS45
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Fischer von Mollard G and Stevens TH (1999) The Saccharomyces cerevisiae v-SNARE Vti1p is required for multiple membrane transport pathways to the vacuole. Mol Biol Cell 10(6):1719-32
       |LAP4 |NYV1 |PEP12 |PHO8 |SED5 |VAM3
Reviews
Gotte M and Lazar T (1999) The ins and outs of yeast vacuole trafficking. Protoplasma 209(1-2):9-18
     |APL5 |APL6 |APM3 |APS3 |CMD1 |CPS1 |KEX2 |NYV1 |PEP1 |PEP12 |PEP5 |PEP8 |PHO8 |SEC17 |MORE
Reviews
Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       |GOS1 |NYV1 |SEC20 |SEC22 |SEC9 |SED5 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |TLG1 |TLG2 |UFE1 |MORE
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Protein/Nucleic Acid Structure
Tishgarten T, et al. (1999) Structures of yeast vesicle trafficking proteins. Protein Sci 8(11):2465-73
     |PEP12
Cellular Location
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Ungermann C, et al. (1999) Three v-SNAREs and two t-SNAREs, present in a pentameric cis-SNARE complex on isolated vacuoles, are essential for homotypic fusion. J Cell Biol 145(7):1435-42
       |NYV1 |VAM3 |VAM7 |YKT6
Cross-species Expression
Non-Fungal Related Genes/Proteins
Zheng H, et al. (1999) The plant vesicle-associated SNARE AtVTI1a likely mediates vesicle transport from the trans-Golgi network to the prevacuolar compartment. Mol Biol Cell 10(7):2251-64
       |PEP12
Cellular Location
Function/Process
Protein Processing/Modification/Regulation
Bryant NJ, et al. (1998) Retrograde traffic out of the yeast vacuole to the TGN occurs via the prevacuolar/endosomal compartment. J Cell Biol 142(3):651-63
       |VAC7
Reviews
Conibear E and Stevens TH (1998) Multiple sorting pathways between the late Golgi and the vacuole in yeast. Biochim Biophys Acta 1404(1-2):211-30
     |APL5 |APL6 |APM3 |APS3 |CHC1 |COP1 |PEP12 |PEP3 |PEP5 |PEP7 |PHO8 |VPS15 |VPS16 |VPS21 |MORE
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Fasshauer D, et al. (1998) Conserved structural features of the synaptic fusion complex: SNARE proteins reclassified as Q- and R-SNAREs. Proc Natl Acad Sci U S A 95(26):15781-6
         |BET1 |BOS1 |NYV1 |SEC22 |SEC9 |SED5 |SNC1 |SPO20 |SSO1 |VAM3 |VAM7
Cross-species Expression
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Strains/Constructs
Fischer von Mollard G and Stevens TH (1998) A human homolog can functionally replace the yeast vesicle-associated SNARE Vti1p in two vesicle transport pathways. J Biol Chem 273(5):2624-30

Reviews
Gotte M and von Mollard GF (1998) A new beat for the SNARE drum. Trends Cell Biol 8(6):215-8
       |SEC17 |SEC18 |SEC22 |SEC9 |SED5 |SNC1 |SSO1 |VAM3
Function/Process
Protein-protein Interactions
Holthuis JC, et al. (1998) Two syntaxin homologues in the TGN/endosomal system of yeast. EMBO J 17(1):113-26
       |SED5 |SNC1 |TLG1 |TLG2
Reviews
Weimbs T, et al. (1998) A model for structural similarity between different SNARE complexes based on sequence relationships. Trends Cell Biol 8(7):260-2
       |BET1 |BOS1 |NYV1 |PEP12 |SEC22 |SEC9 |SNC1 |SPO20 |SSO1
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Lupashin VV, et al. (1997) Characterization of a novel yeast SNARE protein implicated in Golgi retrograde traffic. Mol Biol Cell 8(12):2659-76
       |HSP150 |SEC17 |SEC18 |SEC22 |SED5 |SFT1 |YKT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
von Mollard GF, et al. (1997) The yeast v-SNARE Vti1p mediates two vesicle transport pathways through interactions with the t-SNAREs Sed5p and Pep12p. J Cell Biol 137(7):1511-24
       |PEP12 |SED5

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.