---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP53/YMR153W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 564434 to 565861 CDS: 564434 - 565861 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP53	YMR153W		ORF, Verified	S000004762
Description
Subunit of the nuclear pore complex (NPC), interacts with karyopherin Kap121p or with Nup170p via overlapping regions of Nup53p, involved in activation of the spindle checkpoint mediated by the Mad1p-Mad2p complex

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0132 Assigned on 2007-05-23 UniProtKB establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mitosis GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0498 Assigned on 2007-05-23 UniProtKB nuclear pore organization Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91        IGI : Inferred from Genetic Interaction with SGD:ASM4, SGD:POM34, SGD:POM152 Assigned on 2009-06-25 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus, docking Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        IPI : Inferred from Physical Interaction Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By karyopherin docking complex Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        IDA : Inferred from Direct Assay Assigned on 2009-10-09 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP53/YMR153W for NUP53 NUP53 encodes a recently identified nuclear pore protein, described in (1). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). Nup53p forms a complex with two other nucleoporins, Nup170p and Asm4p. The complex is found on both the nuclear and cytoplasmic faces of the NPC, and associates with Pse1p, a member of a protein family implicated in nuclear protein import, via direct interaction between Nup53p and Pse1p. Nup53p is structurally similar to Asm4p, and similar proteins sequences are found in several eukaryotes including human and other multicellular species. Nup53p is not essential; deletion of NUP53 and ASM4 causes slow growth and altered subcellular distribution of Pse1p. In a nup53 pse1 double mutant, NLS-containing proteins are mislocalized to the cytoplasm. Last Updated: 1999-07-29

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP53/YMR153W for NUP53 1) Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Lusk CP, et al. (2002) Karyopherins in nuclear pore biogenesis: a role for Kap121p in the assembly of Nup53p into nuclear pore complexes. J Cell Biol 159(2):267-78        16) Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP53/YMR153W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP53/YMR153W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MADLQKQ C-term LFGWNDL Length(aa) 475 MW(Da) 52,618 pI 10.33 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.016   Codon Adaptation Index 0.109   Frequency of Optimal Codons 0.394   Hydropathicity of Protein -0.773   Aromaticity Score 0.076

10 20 30 40 50 | | | | | MADLQKQENSSRFTNVSVIAPESQGQHEQQKQQEQLEQQKQPTGLLKGLN GFPSAPQPLFMEDPPSTVSGELNDNPAWFNNPRKRAIPNSIIKRSNGQSL SPVRSDSADVPAFSNSNGFNNVTFGSKKDPRILKNVSPNDNNSANNNAHS SDLGTVVFDSNEAPPKTSLADWQKEDGIFSSKTDNIEDPNLSSNITFDGK PTATPSPFRPLEKTSRILNFFDKNTKTTPNTASSEASAGSKEGASTNWDD HAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSL TAQKYPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAAL KQLASLKKSEEIINNKTSSQTSLSSKDLSNYRKTEGIFEKAKAKAVTSKV RNAEFKVSKNSTSFKNPRRLEIKDGRSLFLRNRGKIHSGVLSSIESDLKK REQASKSKKSWLNRLNNWLFGWNDL*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP53/YMR153W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP53	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YMR153W	SGD Systematic Sequence
855184	NCBI: Gene ID
NP_013873.1	NCBI: RefSeq protein version ID
NP_013873.1	NCBI: RefSeq protein version ID
6323802	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
38 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP157 |NUP170 |NUP188 |NUP2 |NUP82 |POM152 |POM34
Reviews	Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9	|ASM4 |NDC1 |NIC96 |NUP157 |NUP170 |NUP188 |NUP82 |NUP84 |POM152 |POM34 |RTN1 |YOP1
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Protein Sequence Features Protein-Nucleic Acid Interactions Protein-protein Interactions	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Evolution Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP159 |NUP2 |NUP42 |NUP49 |NUP57 |NUP60
Function/Process Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Regulation of Strains/Constructs	Lusk CP, et al. (2007) Nup53p is a Target of Two Mitotic Kinases, Cdk1p and Hrr25p. Traffic 8(6):647-60	|CDC28 |HRR25 |MAD1 |NUP170 |PSE1
Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs	Makhnevych T, et al. (2007) The role of karyopherins in the regulated sumoylation of septins. J Cell Biol 177(1):39-49	|CDC3 |KAP95 |MSN5 |PSE1 |SIZ1 |SRP1 |ULP1
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |MORE
Non-Fungal Related Genes/Proteins Protein/Nucleic Acid Structure	Handa N, et al. (2006) The Crystal Structure of Mouse Nup35 Reveals Atypical RNP Motifs and Novel Homodimerization of the RRM Domain. J Mol Biol 363(1):114-24
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Evolution	Sawyer SL and Malik HS (2006) Positive selection of yeast nonhomologous end-joining genes and a retrotransposon conflict hypothesis. Proc Natl Acad Sci U S A 103(47):17614-9	|DNL4 |LIF1 |MRE11 |NEJ1 |POL4 |RAD50 |SAE2 |XRS2 |YKU70 |YKU80
Function/Process Mutants/Phenotypes Strains/Constructs	Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99	|ESC1 |NUP120 |NUP133 |NUP145 |NUP170 |NUP84 |SIR4 |TEL11L |YKU70
Non-Fungal Related Genes/Proteins	Hawryluk-Gara LA, et al. (2005) Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex. Mol Biol Cell 16(5):2382-94
Protein Processing/Modification/Regulation	Mason DA, et al. (2005) Increased nuclear envelope permeability and Pep4p-dependent degradation of nucleoporins during hydrogen peroxide-induced cell death. FEMS Yeast Res 5(12):1237-51	|MCA1 |NSP1 |NUP1 |NUP100 |NUP116 |NUP159 |NUP84 |NUP85 |PAI3 |PEP4 |POM152 |PRB1 |SEH1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Menon BB, et al. (2005) Reverse recruitment: the Nup84 nuclear pore subcomplex mediates Rap1/Gcr1/Gcr2 transcriptional activation. Proc Natl Acad Sci U S A 102(16):5749-54	|GCN4 |GCR1 |GCR2 |KAP123 |NOP1 |NUP120 |NUP133 |NUP145 |NUP84 |NUP85 |POM152 |POM34 |RAP1 |SEC13 |MORE
Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Scott RJ, et al. (2005) Interactions between Mad1p and the nuclear transport machinery in the yeast Saccharomyces cerevisiae. Mol Biol Cell 16(9):4362-74	|KAP95 |MAD1 |MLP1 |MLP2 |NUP170 |NUP2 |NUP60 |POM34 |PSE1
Fungal Related Genes/Proteins	Chen XQ, et al. (2004) Identification of genes encoding putative nucleoporins and transport factors in the fission yeast Schizosaccharomyces pombe: a deletion analysis. Yeast 21(6):495-509	|CSE1 |MLP1 |NUP120 |NUP133 |NUP2 |NUP84 |NUP85
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Reviews	Lew DJ and Burke DJ (2003) The spindle assembly and spindle position checkpoints. Annu Rev Genet 37:251-82	|AMA1 |APC1 |APC11 |APC2 |APC4 |APC5 |APC9 |BFA1 |BUB1 |BUB2 |BUB3 |CDC14 |CDC15 |CDC16 |MORE
Cell Cycle Phase Involved Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Makhnevych T, et al. (2003) Cell cycle regulated transport controlled by alterations in the nuclear pore complex. Cell 115(7):813-23	|PSE1
Mutants/Phenotypes	Willingham S, et al. (2003) Yeast genes that enhance the toxicity of a mutant huntingtin fragment or alpha-synuclein. Science 302(5651):1769-72	|ABZ2 |AIM46 |ALB1 |APE2 |APJ1 |APM2 |ARL3 |ARO1 |ATG15 |AYR1 |CIT2 |CMK1 |COG6 |COS111 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19	|ASM4 |MAD1 |MAD2 |NUP100 |NUP157 |NUP170 |NUP188 |POM152
Function/Process Protein-protein Interactions	Lusk CP, et al. (2002) Karyopherins in nuclear pore biogenesis: a role for Kap121p in the assembly of Nup53p into nuclear pore complexes. J Cell Biol 159(2):267-78	|KAP95 |NUP170 |PSE1 |SRP1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Marelli M, et al. (2001) A link between the synthesis of nucleoporins and the biogenesis of the nuclear envelope. J Cell Biol 153(4):709-24	|ASM4 |NDC1 |NUP170 |POM152 |PSE1
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Fahrenkrog B, et al. (2000) The yeast nucleoporin Nup53p specifically interacts with Nic96p and is directly involved in nuclear protein import. Mol Biol Cell 11(11):3885-96	|NIC96
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Cell Cycle Phase Involved Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs Techniques and Reagents	Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30	|ASM4 |NMD5 |NUP170 |POM152 |PSE1
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE

Return to SGD

Send a Message to the SGD Curators