---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AAC1/YMR056C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 388243 to 387314 CDS: 388243 - 387314 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AAC1	YMR056C		ORF, Verified	S000004660
See Nomenclature Note.
Description
Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP:ADP antiporter activity Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8      IDA : Inferred from Direct Assay Assigned on 2001-02-13 SGD binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 Assigned on 2007-05-23 UniProtKB transporter activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002113 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By aerobic respiration Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8      IGI : Inferred from Genetic Interaction with SGD:PET9 Assigned on 2004-02-26 SGD heme biosynthetic process Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070          IGI : Inferred from Genetic Interaction with SGD:AAC3, SGD:PET9 Assigned on 2008-09-09 SGD mitochondrial transport Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8      IGI : Inferred from Genetic Interaction with SGD:PET9 Assigned on 2004-02-26 SGD oxidation reduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 , EBI:IPR002113 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 , EBI:IPR002113 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial inner membrane Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002067 , EBI:IPR002113 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0999 Assigned on 2009-06-29 UniProtKB mitochondrion Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forAAC1/YMR056C for AAC1 1) Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8      2) Reinders J, et al. (2007) Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase. Mol Cell Proteomics 6(11):1896-906        3) Lawson JE and Douglas MG (1988) Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2. J Biol Chem 263(29):14812-8

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AAC1/YMR056C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AAC1/YMR056C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSHTETQ C-term MFGKKFK Length(aa) 309 MW(Da) 34,120 pI 10.54 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.161   Codon Adaptation Index 0.116   Frequency of Optimal Codons 0.478   Hydropathicity of Protein 0.006   Aromaticity Score 0.123	10 20 30 40 50 | | | | | MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQ GSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDK IKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADA RGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFG LYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMMTS GQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQ LIMFGKKFK*

Protein Structures from PDB: proteins of known structure with sequence similarity to AAC1/YMR056C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to AAC1 Homolog Source (per PDB) Protein Alignment: AAC1 vs. Homolog External Links P-Value %Identical %Similar Alignment 1okc ( Chain: A) Structure of mitochondrial adp/atp carrier in complex with carboxyatractyloside PDB_Info PDB_Structure Bos taurus 9.0e-65 53 24 View alignment SCOP MMDB CATH 2c3e ( Chain: A) The bovine mitochondrial adp-atp carrier PDB_Info PDB_Structure Bos taurus 9.0e-65 53 24 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
AAC1	SGD (2007) Information without a citation in SGD

Nomenclature History Notes

Date	Note
2003-12-09	ANC1 has been used to refer to both AAC1/YMR056C, which encodes a mitochondrial ADP/ATP translocator, and TAF14/YPL129W, which encodes a transcription factor subunit.

Mapping Notes

Date	Note
1997-10-20	Edition 14: AAC1 has also been referred to by the name ANC1 but should not be confused with the transcription initiation factor TFIIF subunit by that name Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YMR056C	SGD Systematic Sequence
855078	NCBI: Gene ID
NP_013772.1	NCBI: RefSeq protein version ID
NP_013772.1	NCBI: RefSeq protein version ID
6323701	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
55 curated references; 0 references not yet curated
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Feng J, et al. (2009) Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria. Am J Physiol Cell Physiol	|AAC3 |PET9
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |APN2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070	|AAC3 |ATP3 |CTA1 |PET9
Protein-protein Interactions Regulation of	Claypool SM, et al. (2008) Cardiolipin defines the interactome of the major ADP/ATP carrier protein of the mitochondrial inner membrane. J Cell Biol 182(5):937-50	|ADH3 |COB |COR1 |COX12 |COX13 |COX2 |COX4 |COX5A |COX6 |CRD1 |CYC1 |CYT1 |DIC1 |DLD1 |MORE
Function/Process Regulation of	Dikicioglu D, et al. (2008) Integration of metabolic modeling and phenotypic data in evaluation and improvement of ethanol production using respiration-deficient mutants of Saccharomyces cerevisiae. Appl Environ Microbiol 74(18):5809-16	|AAT2 |ACS1 |ADH5 |ARG1 |ARG3 |ARG4 |ATP1 |CAR1 |CAT2 |CPA2 |CYT1 |DIC1 |ENO1 |ERR1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Kucejova B, et al. (2008) Pleiotropic effects of the yeast Sal1 and Aac2 carriers on mitochondrial function via an activity distinct from adenine nucleotide transport. Mol Genet Genomics 280(1):25-39	|GGC1 |MTG1 |PET9 |SAL1 |SHY1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Mroczek S and Kufel J (2008) Apoptotic signals induce specific degradation of ribosomal RNA in yeast. Nucleic Acids Res 36(9):2874-88	|AAC3 |AHP1 |AIF1 |DOT5 |GPX1 |GPX2 |GRX1 |GRX2 |GSH1 |HTB1 |HTB2 |HYR1 |MCA1 |PET9 |MORE
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Smith CP and Thorsness PE (2008) The Molecular Basis for Relative Physiological Functionality of the ADP/ATP Carrier Isoforms in Saccharomyces cerevisiae. Genetics 179(3):1285-99	|AAC3 |PET9 |SAL1
Function/Process Genetic Interactions Strains/Constructs Substrates/Ligands/Cofactors	Traba J, et al. (2008) Yeast mitochondria import ATP through the calcium-dependent ATP-Mg/Pi carrier Sal1p, and are ATP consumers during aerobic growth in glucose. Mol Microbiol 69(3):570-85	|MRS2 |PET9 |SAL1
Genetic Interactions Strains/Constructs	Buttner S, et al. (2007) Endonuclease g regulates budding yeast life and death. Mol Cell 25(2):233-46	|AAC3 |AIF1 |HHF1 |HHF2 |HTB1 |HTB2 |KAP123 |MCA1 |NUC1 |PET9 |POR1
Mutants/Phenotypes Strains/Constructs	Hjersted JL, et al. (2007) Genome-scale analysis of Saccharomyces cerevisiae metabolism and ethanol production in fed-batch culture. Biotechnol Bioeng 97(5):1190-204	|GDH1 |GDH2 |GLN1 |GLT1
Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors	Kihira Y, et al. (2007) Difference between Yeast and Bovine Mitochondrial ADP/ATP Carriers in Terms of Conformational Properties of the First Matrix Loop as Deduced by Use of Copper-o-phenanthroline. Biol Pharm Bull 30(5):885-90	|PET9
Function/Process Mutants/Phenotypes Strains/Constructs	Pereira C, et al. (2007) ADP/ATP carrier is required for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis. Mol Microbiol 66(3):571-82	|AAC3 |ATP2 |CPR3 |MCA1 |PET9 |POR1
Protein Processing/Modification/Regulation Protein Sequence Features	Reinders J, et al. (2007) Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase. Mol Cell Proteomics 6(11):1896-906	|ACH1 |ACO1 |ADY2 |ALD4 |ATO2 |ATO3 |ATP1 |ATP15 |ATP16 |ATP2 |ATP20 |ATP4 |ATP5 |CBP6 |MORE
Regulation of Transcription	Vemuri GN, et al. (2007) Increasing NADH oxidation reduces overflow metabolism in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(7):2402-7	|AAH1 |ADH1 |ADH2 |ADH3 |ALD4 |ALD5 |ALD6 |CIT1 |CSG2 |CYB2 |DAK2 |ENO1 |ERG25 |FAA2 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |AQY1 |MORE
Cross-species Expression Fungal Related Genes/Proteins	Fontanesi F, et al. (2006) Heterologous complementation of the Klaac null mutation of Kluyveromyces lactis by the Saccharomyces cerevisiae AAC3 gene encoding the ADP/ATP carrier. FEMS Yeast Res 6(3):414-20	|AAC3 |PET9
Strains/Constructs	Lodi T, et al. (2006) Mutation D104G in ANT1 gene: complementation study in Saccharomyces cerevisiae as a model system. Biochem Biophys Res Commun 341(3):810-5	|PET9
Reviews	Palmieri F, et al. (2006) Identification of mitochondrial carriers in Saccharomyces cerevisiae by transport assay of reconstituted recombinant proteins. Biochim Biophys Acta 1757(9-10):1249-62	|AAC3 |AGC1 |ANT1 |CAT2 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK1 |MORE
Protein-protein Interactions Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |ALD5 |MORE
Reviews	Arco AD and Satrustegui J (2005) New mitochondrial carriers: an overview. Cell Mol Life Sci 62(19-20):2204-27	|AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |OAC1 |ODC1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cavero S, et al. (2005) The calcium-dependent ATP-Mg/Pi mitochondrial carrier is a target of glucose-induced calcium signalling in Saccharomyces cerevisiae. Biochem J 392(Pt 3):537-44	|AAC3 |PET9 |SAL1
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Dyczkowski J and Vingron M (2005) Comparative analysis of cell cycle regulated genes in eukaryotes. Genome Inform 16(1):125-31	|CDC45 |CPR1 |DBF20 |DSK2 |FKH1 |FKH2 |HHF1 |HHF2 |HHT1 |HHT2 |HOF1 |HTA1 |HTA2 |HTB1 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |ARX1 |MORE
Cross-species Expression	Monne M, et al. (2005) Functional expression of eukaryotic membrane proteins in Lactococcus lactis. Protein Sci 14(12):3048-56	|AAC3 |DIC1 |GGC1 |MIR1 |OAC1 |ODC1 |ODC2 |PET8 |PET9
Function/Process Fungal Related Genes/Proteins Genetic Interactions Strains/Constructs	Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17	|AAC3 |PET9 |SAL1
Fungal Related Genes/Proteins	Zhang Z and Kishino H (2004) Genomic background predicts the fate of duplicated genes: evidence from the yeast genome. Genetics 166(4):1995-9	|ALD4 |ALD5 |BDH1 |BDH2 |CAM1 |CCT4 |CCT6 |CDC19 |CLB3 |CLB4 |CYS3 |DCS1 |DCS2 |EMI2 |MORE
Cellular Location Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Dyall SD, et al. (2003) The dynamic dimerization of the yeast ADP/ATP carrier in the inner mitochondrial membrane is affected by conserved cysteine residues. J Biol Chem 278(29):26757-64	|PET9 |TIM10 |TIM22
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |ADY2 |MORE
Fungal Related Genes/Proteins	Heimpel S, et al. (2001) Expression of the mitochondrial ADP/ATP carrier in Escherichia coli. Renaturation, reconstitution, and the effect of mutations on 10 positive residues. J Biol Chem 276(15):11499-506	|PET9
Fungal Related Genes/Proteins	Wiedemann N, et al. (2001) The three modules of ADP/ATP carrier cooperate in receptor recruitment and translocation into mitochondria. EMBO J 20(5):951-60	|AAC3 |PET9 |TOM70
Techniques and Reagents	Young L, et al. (2001) Role of the ABC transporter Mdl1 in peptide export from mitochondria. Science 291(5511):2135-8	|AFG3 |MDL1 |MDL2 |MGE1 |TIM17 |TOM70 |YME1 |YTA12
Cellular Location Translational Regulation	Corral-Debrinski M, et al. (2000) In yeast, the 3' untranslated region or the presequence of ATM1 is required for the exclusive localization of its mRNA to the vicinity of mitochondria. Mol Cell Biol 20(21):7881-92	|ATM1 |ATP2 |COT1 |COX10 |COX5A |COX6 |MIR1 |TIM44
Non-Fungal Related Genes/Proteins	Dyall SD, et al. (2000) Presence of a member of the mitochondrial carrier family in hydrogenosomes: conservation of membrane-targeting pathways between hydrogenosomes and mitochondria. Mol Cell Biol 20(7):2488-97	|AAC3 |PET9 |TIM10 |TIM9
Fungal Related Genes/Proteins	Fiore C, et al. (2000) Purification of histidine-tagged mitochondrial ADP/ATP carrier: influence of the conformational states of the C-terminal region. Protein Expr Purif 19(1):57-65	|AAC3 |PET9
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kissova I, et al. (2000) The cytotoxic action of Bax on yeast cells does not require mitochondrial ADP/ATP carrier but may be related to its import to the mitochondria. FEBS Lett 471(1):113-8	|AAC3 |PET9
Protein Processing/Modification/Regulation Protein-protein Interactions	Ryan MT, et al. (1999) Functional staging of ADP/ATP carrier translocation across the outer mitochondrial membrane. J Biol Chem 274(29):20619-27	|AAC3 |PET9 |SAM37 |TIM10 |TOM20 |TOM40 |TOM70
Function/Process Fungal Related Genes/Proteins Genetic Interactions Strains/Constructs	Viola AM, et al. (1999) A Klaac null mutant of Kluyveromyces lactis is complemented by a single copy of the Saccharomyces cerevisiae AAC1 gene. Curr Genet 36(1-2):29-36	|HAP2 |PET9
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Joseph-Liauzun E, et al. (1997) The Mr 18,000 subunit of the peripheral-type benzodiazepine receptor exhibits both benzodiazepine and isoquinoline carboxamide binding sites in the absence of the voltage-dependent anion channel or of the adenine nucleotide carrier. J Biol Chem 272(44):28102-6	|AAC3 |PET9 |POR1
Cellular Location Function/Process Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure	el Moualij B, et al. (1997) Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae. Yeast 13(6):573-81	|AAC3 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |OAC1 |MORE
Function/Process Fungal Related Genes/Proteins	Couzin N, et al. (1996) Cloning of the gene encoding the mitochondrial adenine nucleotide carrier of Schizosaccharomyces pombe by functional complementation in Saccharomyces cerevisiae. Gene 171(1):113-7	|AAC3 |PET9
Cellular Location DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins RNA Levels and Processing Regulation of Strains/Constructs	Gavurnikova G, et al. (1996) Transcription of the AAC1 gene encoding an isoform of mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is regulated by oxygen in a heme-independent manner. Eur J Biochem 239(3):759-63	|AAC3 |PET9
Fungal Related Genes/Proteins	Betina S, et al. (1995) Expression of the AAC2 gene encoding the major mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is controlled at the transcriptional level by oxygen, heme and HAP2 factor. Eur J Biochem 229(3):651-7	|AAC3 |ABF1 |HAP2 |HAP3 |PET9
Fungal Related Genes/Proteins Protein Sequence Features	Viola AM, et al. (1995) A kluyveromyces lactis gene homologue to AAC2 complements the Saccaromyces cerevisiae op1 mutation. Curr Genet 27(3):229-33	|PET9
Function/Process Fungal Related Genes/Proteins	Hoffmann B, et al. (1994) The reconstituted ADP/ATP carrier activity has an absolute requirement for cardiolipin as shown in cysteine mutants. J Biol Chem 269(3):1940-4	|PET9
Fungal Related Genes/Proteins	Brandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50	|AAC3 |PET9
Function/Process Fungal Related Genes/Proteins	Nelson DR and Douglas MG (1993) Function-based mapping of the yeast mitochondrial ADP/ATP translocator by selection for second site revertants. J Mol Biol 230(4):1171-82	|PET9
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Drgon T, et al. (1992) Yeast ADP/ATP carrier (AAC) proteins exhibit similar enzymatic properties but their deletion produces different phenotypes. FEBS Lett 304(2-3):277-80	|AAC3 |PET9
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Drgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62	|AAC3 |PET9
Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8	|PET9
Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing Regulation of Strains/Constructs	Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6	|AAC3 |PET9
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Lawson JE, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. I. Construction and genetic analysis of yeast mutants encoding the ADP/ATP carrier protein of mitochondria. J Biol Chem 265(24):14195-201	|PET9
Function/Process Fungal Related Genes/Proteins Genetic Interactions Protein Sequence Features Regulation of Strains/Constructs	Lawson JE and Douglas MG (1988) Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2. J Biol Chem 263(29):14812-8	|PET9

Return to SGD

Send a Message to the SGD Curators