---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP116/YMR047C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 366704 to 363363 CDS: 366704 - 363363 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP116	YMR047C	NSP116	ORF, Verified	S000004650
Description
Subunit of the Nup82 subcomplex of the nuclear pore complex; localized to both sides of the pore; contains a repetitive GLFG motif that interacts with mRNA export factor Mex67p and with karyopherin Kap95p; homologous to Nup100p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Sarkar S and Hopper AK (1998) tRNA nuclear export in saccharomyces cerevisiae: in situ hybridization analysis. Mol Biol Cell 9(11):3041-55        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD tRNA splicing, via endonucleolytic cleavage and ligation Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup82 complex Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51        IDA : Inferred from Direct Assay Assigned on 2009-10-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP116/YMR047C for NUP116 NUP116 encodes a nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). NUP116 is not essential, but the null mutant is temperature sensitive, and nup116 mutants have defects in nuclear RNA export and nuclear tRNA export and altered nuclear envelope morphology (15, 16, 2, 17). Nup116p is one of a group of nucleoporins that contain multiple repeats of the amino acids GLFG (1, 18, 2). Nup100p and Nup116p are similar over their entire lengths, and may have arisen by gene duplication (1, 19, 2). Deletion of the GLFG repeats from Nup116p causes a defect in nuclear protein import (20, 2). Nup116p interacts with two nuclear transport factors, Kap95p (20) and Pse1p (21). The interaction with Kap95p involves the GLFG repeats of Nup116p (20). Nup116p is stoichiometrically bound to the mRNA transport factor Gle2p, forming a stable complex, via a short sequence (the GLEBS) also found in nucleoporins from rat and Xenopus (22). A related nucleoporin, Nup98, has been identified in vertebrates (2, 23, 24). Last Updated: 1999-08-06

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP116/YMR047C for NUP116 1) Wente SR, et al. (1992) A new family of yeast nuclear pore complex proteins. J Cell Biol 119(4):705-23      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Wente SR and Blobel G (1993) A temperature-sensitive NUP116 null mutant forms a nuclear envelope seal over the yeast nuclear pore complex thereby blocking nucleocytoplasmic traffic. J Cell Biol 123(2):275-84      16) Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301        17) Sarkar S and Hopper AK (1998) tRNA nuclear export in saccharomyces cerevisiae: in situ hybridization analysis. Mol Biol Cell 9(11):3041-55        18) Wimmer C, et al. (1992) A new subclass of nucleoporins that functionally interact with nuclear pore protein NSP1. EMBO J 11(13):5051-61      19) Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69      20) Iovine MK, et al. (1995) The GLFG repetitive region of the nucleoporin Nup116p interacts with Kap95p, an essential yeast nuclear import factor. J Cell Biol 131(6 Pt 2):1699-713      21) Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57        22) Bailer SM, et al. (1998) Nup116p and nup100p are interchangeable through a conserved motif which constitutes a docking site for the mRNA transport factor gle2p. EMBO J 17(4):1107-19        23) Pritchard CE, et al. (1999) RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains. J Cell Biol 145(2):237-54        24) Fontoura BM, et al. (1999) A conserved biogenesis pathway for nucleoporins: proteolytic processing of a 186-kilodalton precursor generates Nup98 and the novel nucleoporin, Nup96. J Cell Biol 144(6):1097-112        25) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        26) Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52        27) Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP116/YMR047C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP116/YMR047C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFGVSRG C-term NHAAEQT Length(aa) 1,113 MW(Da) 116,234 pI 10.13 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.076   Codon Adaptation Index 0.121   Frequency of Optimal Codons 0.444   Hydropathicity of Protein -0.727   Aromaticity Score 0.078

10 20 30 40 50 | | | | | MFGVSRGAFPSATTQPFGSTGSTFGGQQQQQQPVANTSAFGLSQQTNTTQ APAFGNFGNQTSNSPFGMSGSTTANGTPFGQSQLTNNNASGSIFGGMGNN TALSAGSASVVPNSTAGTSIKPFTTFEEKDPTTGVINVFQSITCMPEYRN FSFEELRFQDYQAGRKFGTSQNGTGTTFNNPQGTTNTGFGIMGNNNSTTS ATTGGLFGQKPATGMFGTGTGSGGGFGSGATNSTGLFGSSTNLSGNSAFG ANKPATSGGLFGNTTNNPTNGTNNTGLFGQQNSNTNGGLFGQQQNSFGAN NVSNGGAFGQVNRGAFPQQQTQQGSGGIFGQSNANANGGAFGQQQGTGAL FGAKPASGGLFGQSAGSKAFGMNTNPTGTTGGLFGQTNQQQSGGGLFGQQ QNSNAGGLFGQNNQSQNQSGLFGQQNSSNAFGQPQQQGGLFGSKPAGGLF GQQQGASTFASGNAQNNSIFGQNNQQQQSTGGLFGQQNNQSQSQPGGLFG QTNQNNNQPFGQNGLQQPQQNNSLFGAKPTGFGNTSLFSNSTTNQSNGIS GNNLQQQSGGLFQNKQQPASGGLFGSKPSNTVGGGLFGNNQVANQNNPAS TSGGLFGSKPATGSLFGGTNSTAPNASSGGIFGSNNASNTAATTNSTGLF GNKPVGAGASTSAGGLFGNNNNSSLNNSNGSTGLFGSNNTSQSTNAGGLF QNNTSTNTSGGGLFSQPSQSMAQSQNALQQQQQQQRLQIQNNNPYGTNEL FSKATVTNTVSYPIQPSATKIKADERKKASLTNAYKMIPKTLFTAKLKTN NSVMDKAQIKVDPKLSISIDKKNNQIAISNQQEENLDESILKASELLFNP DKRSFKNLINNRKMLIASEEKNNGSQNNDMNFKSKSEEQETILGKPKMDE KETANGGERMVLSSKNDGEDSATKHHSRNMDEENKENVADLQKQEYSEDD KKAVFADVAEKDASFINENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSY GKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVR ARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSG TYVFIVNHAAEQT*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP116/YMR047C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP116 Homolog Source (per PDB) Protein Alignment: NUP116 vs. Homolog External Links P-Value %Identical %Similar Alignment 2aiv ( Chain: A) Multiple conformations in the ligand-binding site of the yeast nuclear pore targeting domain of nup116p PDB_Info PDB_Structure Saccharomyces cerevisiae 1.2e-46 100 0 View alignment SCOP MMDB CATH 3hr2 ( Chain: B, C, A) Collagen alpha-2(I) ch PDB_Info PDB_Structure Unknown Chain B = 3.1e-08 24 26 View alignment SCOP MMDB CATH Chain C = 1.2e-07 22 25 View alignment Chain A = 1.2e-07 22 25 View alignment 3hqv ( Chain: B, C, A) Collagen alpha-2(I) ch PDB_Info PDB_Structure Unknown Chain B = 3.1e-08 24 26 View alignment SCOP MMDB CATH Chain C = 1.2e-07 22 25 View alignment Chain A = 1.2e-07 22 25 View alignment 2q5x ( Chain: A) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens 2.4e-05 29 37 View alignment SCOP MMDB CATH 2q5y ( Chain: C, A) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens Chain C = 3.5e-05 29 37 View alignment SCOP MMDB CATH Chain A = 3.5e-05 29 37 View alignment 1ko6 ( Chain: C, A) Crystal structure of c-terminal autoproteolytic domain of nucleoporin nup98 PDB_Info PDB_Structure Homo sapiens Chain C = 4.4e-05 29 37 View alignment SCOP MMDB CATH Chain A = 4.4e-05 29 37 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP116	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YMR047C	SGD Systematic Sequence
855066	NCBI: Gene ID
NP_013762.1	NCBI: RefSeq protein version ID
NP_013762.1	NCBI: RefSeq protein version ID
6323691	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
80 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP133 |NUP145 |NUP159 |NUP188 |MORE
Computational analysis Protein Sequence Features Protein-protein Interactions Strains/Constructs	Alberti S, et al. (2009) A systematic survey identifies prions and illuminates sequence features of prionogenic proteins. Cell 137(1):146-58	|AIM3 |AKL1 |ASM4 |AZF1 |CAF40 |CBK1 |CCR4 |CLA4 |CYC8 |DDR48 |DEF1 |ENT1 |ENT2 |EPL1 |MORE
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP120 |NUP133 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Computational analysis Protein-protein Interactions	Gopalacharyulu PV, et al. (2009) Dynamic network topology changes in functional modules predict responses to oxidative stress in yeast. Mol Biosyst 5(3):276-87	|ATP14 |BZZ1 |CDC28 |HHF1 |HHF2 |IFA38 |JSN1 |PHO88 |RPB9 |RPC40 |SER3 |SRB4 |SRP1 |SUA7 |MORE
Mutants/Phenotypes Strains/Constructs	Bolger TA, et al. (2008) The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation. Cell 134(4):624-33	|ARG82 |DBP5 |GLE1 |IPK1 |NAB2 |NIP1 |NUP159 |PRT1 |SUP35 |SUP45 |TIF35
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP100 |NUP120 |NUP133 |NUP42 |NUP57 |NUP82 |MORE
Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure	Krishnan VV, et al. (2008) Intramolecular cohesion of coils mediated by phenylalanine--glycine motifs in the natively unfolded domain of a nucleoporin. PLoS Comput Biol 4(8):e1000145
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP53 |NUP60 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Protein-protein Interactions	Rougemaille M, et al. (2008) THO/Sub2p functions to coordinate 3'-end processing with gene-nuclear pore association. Cell 135(2):308-21	|GLE1 |HPR1 |HSP104 |MEX67 |MFT1 |NUP60 |PAP1 |PCF11 |RNA14 |RNA15 |SUB2 |THO2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Wu X and Jiang YW (2008) Overproduction of non-translatable mRNA silences. The transcription of Ty1 retrotransposons in S. cerevisiae via functional inactivation of the nuclear cap-binding complex and subsequent hyperstimulation of the TORC1 pathway. Yeast 25(5):327-47	|BCY1 |BMH1 |BMH2 |CBC2 |FUS3 |GLC7 |KEM1 |NAM7 |NMD2 |PHO80 |PHO85 |REG1 |SNF1 |STO1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |MTR2 |NMD3 |NUP120 |NUP145 |NUP159 |NUP82 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |MORE
Evolution Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP100 |NUP159 |NUP2 |NUP42 |NUP49 |NUP53 |NUP57 |NUP60
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Cellular Location Protein-protein Interactions Strains/Constructs	McGuire AT and Mangroo D (2007) Cex1p is a novel cytoplasmic component of the Saccharomyces cerevisiae nuclear tRNA export machinery. EMBO J 26(2):288-300	|ARC1 |CCA1 |CEX1 |GSP1 |LOS1 |MSN5 |NUP2 |NUP57 |TEF2
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |MORE
Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions	Ratner GA, et al. (2007) Molecular Determinants of Binding between Gly-Leu-Phe-Gly Nucleoporins and the Nuclear Pore Complex. J Biol Chem 282(47):33968-76	|NUP100 |NUP145
Protein-protein Interactions	Strub BR, et al. (2007) Utp8p Is a Nucleolar tRNA-binding Protein That Forms a Complex with Components of the Nuclear tRNA Export Machinery in Saccharomyces cerevisiae. Mol Biol Cell 18(10):3845-59	|CCA1 |CRM1 |GRS1 |GSP1 |LOS1 |MSN5 |NAN1 |NOC4 |NOP14 |NOP58 |NUP170 |POM152 |RRS1 |TYS1 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP1 |NUP100 |NUP145 |NUP2 |NUP49 |NUP57 |NUP60 |PSE1
DNA/RNA Sequence Features Techniques and Reagents	Ayoub MJ, et al. (2006) Application of Multi Locus Sequence Typing to the analysis of the biodiversity of indigenous Saccharomyces cerevisiae wine yeasts from Lebanon. J Appl Microbiol 100(4):699-711	|ATF1 |MET4 |RPN2 |STE50 |YBL081W
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Protein Physical Properties Protein Sequence Features Protein-protein Interactions	Frey S, et al. (2006) FG-rich repeats of nuclear pore proteins form a three-dimensional meshwork with hydrogel-like properties. Science 314(5800):815-7	|NSP1 |NUP145 |NUP49 |NUP57
Cellular Location Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP120 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47	|ALG12 |NIC96 |NUP1 |NUP82 |POM152
Function/Process Protein-Nucleic Acid Interactions	Casolari JM, et al. (2005) Developmentally induced changes in transcriptional program alter spatial organization across chromosomes. Genes Dev 19(10):1188-98	|CRM1 |MLP1 |MLP2
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Protein Processing/Modification/Regulation	Mason DA, et al. (2005) Increased nuclear envelope permeability and Pep4p-dependent degradation of nucleoporins during hydrogen peroxide-induced cell death. FEMS Yeast Res 5(12):1237-51	|MCA1 |NSP1 |NUP1 |NUP100 |NUP159 |NUP53 |NUP84 |NUP85 |PAI3 |PEP4 |POM152 |PRB1 |SEH1
Function/Process Protein-protein Interactions	Nazarenus T, et al. (2005) Upf1p, a highly conserved protein required for nonsense-mediated mRNA decay, interacts with the nuclear pore proteins Nup100p and Nup116p. Gene 345(2):199-212	|GSY1 |NAM7 |NUP100
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Robinson MA, et al. (2005) Multiple conformations in the ligand-binding site of the yeast nuclear pore-targeting domain of Nup116p. J Biol Chem 280(42):35723-32	|NUP100 |NUP145
Mutants/Phenotypes Strains/Constructs	Aye M, et al. (2004) Host factors that affect Ty3 retrotransposition in Saccharomyces cerevisiae. Genetics 168(3):1159-76	|AIM5 |AMS1 |BRO1 |CDC39 |CDH1 |CKA1 |CRG1 |CYR1 |DAP1 |DML1 |ECM30 |FLC2 |FLO5 |FRE3 |MORE
Function/Process Mutants/Phenotypes Protein Physical Properties Protein-protein Interactions	Kiseleva E, et al. (2004) Yeast nuclear pore complexes have a cytoplasmic ring and internal filaments. J Struct Biol 145(3):272-88	|NSP1 |NUP159 |NUP49 |NUP57
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miller AL, et al. (2004) Cytoplasmic inositol hexakisphosphate production is sufficient for mediating the Gle1-mRNA export pathway. J Biol Chem 279(49):51022-32	|GLE1 |GLE2 |IPK1 |MSS4 |NUP159 |NUP42
Function/Process Mutants/Phenotypes Strains/Constructs	Das B, et al. (2003) Degradation of normal mRNA in the nucleus of Saccharomyces cerevisiae. Mol Cell Biol 23(16):5502-15	|NAM7 |RAI1 |RAT1 |RRP6 |STO1
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Protein-protein Interactions	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP100 |NUP120 |NUP133 |NUP159 |NUP2 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Damelin M and Silver PA (2002) In situ analysis of spatial relationships between proteins of the nuclear pore complex. Biophys J 83(6):3626-36	|NIC96 |NUP120 |NUP82
Cellular Location Genetic Interactions Mutants/Phenotypes	Sondermann H, et al. (2002) Prediction of novel Bag-1 homologs based on structure/function analysis identifies Snl1p as an Hsp70 co-chaperone in Saccharomyces cerevisiae. J Biol Chem 277(36):33220-7	|SNL1 |SSA1 |SSA4 |SSB1 |SSQ1
Function/Process Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2001) Proteomic analysis of nucleoporin interacting proteins. J Biol Chem 276(31):29268-74	|GSP1 |KAP95 |NUP1 |NUP100 |NUP2 |NUP42 |NUP49 |NUP57 |NUP60 |NUP84 |SRP1
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Strawn LA, et al. (2001) The GLFG regions of Nup116p and Nup100p serve as binding sites for both Kap95p and Mex67p at the nuclear pore complex. J Biol Chem 276(9):6445-52	|DBP5 |GLE1 |GLE2 |KAP95 |MEX67 |MTR2 |NUP100
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |MORE
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Bailer SM, et al. (2000) Nup116p associates with the Nup82p-Nsp1p-Nup159p nucleoporin complex. J Biol Chem 275(31):23540-8	|GLE2 |NSP1 |NUP159 |NUP82
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Ho AK, et al. (2000) Assembly and preferential localization of Nup116p on the cytoplasmic face of the nuclear pore complex by interaction with Nup82p. Mol Cell Biol 20(15):5736-48	|GLE1 |NSP1 |NUP159 |NUP82
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71	|CRM1 |GLE1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NIC96 |NMD5 |NSP1 |NUP159 |NUP170 |NUP82 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Strasser K, et al. (2000) Binding of the Mex67p/Mtr2p heterodimer to FXFG, GLFG, and FG repeat nucleoporins is essential for nuclear mRNA export. J Cell Biol 150(4):695-706	|GLE2 |MEX67 |MTR2 |NSP1 |NUP159 |NUP42
Non-Fungal Related Genes/Proteins	Pritchard CE, et al. (1999) RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains. J Cell Biol 145(2):237-54	|GLE2
Non-Fungal Related Genes/Proteins	Rosenblum JS and Blobel G (1999) Autoproteolysis in nucleoporin biogenesis. Proc Natl Acad Sci U S A 96(20):11370-5	|NUP145
Protein-protein Interactions	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GLE2 |GSP1 |KAP95 |NSP1 |NUP1 |NUP145 |NUP159 |NUP82 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions	Bailer SM, et al. (1998) Nup116p and nup100p are interchangeable through a conserved motif which constitutes a docking site for the mRNA transport factor gle2p. EMBO J 17(4):1107-19	|GLE2 |NUP100
Cellular Location Function/Process Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NIC96 |NSP1 |NUP120 |NUP145 |NUP159 |NUP49 |NUP57 |NUP82 |POM152
Genetic Interactions Mutants/Phenotypes	Ho AK, et al. (1998) The integral membrane protein snl1p is genetically linked to yeast nuclear pore complex function. Mol Biol Cell 9(2):355-73	|GLE2 |NIC96 |NUP100 |POM152 |SNL1
Function/Process	Sarkar S and Hopper AK (1998) tRNA nuclear export in saccharomyces cerevisiae: in situ hybridization analysis. Mol Biol Cell 9(11):3041-55	|LOS1 |NUP159 |RNA1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Function/Process Genetic Interactions Protein-protein Interactions Strains/Constructs Techniques and Reagents	Iovine MK and Wente SR (1997) A nuclear export signal in Kap95p is required for both recycling the import factor and interaction with the nucleoporin GLFG repeat regions of Nup116p and Nup100p. J Cell Biol 137(4):797-811	|GLE2 |GSP1 |KAP95 |NUP1 |NUP100 |SRP1
Fungal Related Genes/Proteins	Teixeira MT, et al. (1997) Two functionally distinct domains generated by in vivo cleavage of Nup145p: a novel biogenesis pathway for nucleoporins. EMBO J 16(16):5086-97	|NUP100 |NUP120 |NUP145 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP120 |NUP133 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Function/Process Mutants/Phenotypes Strains/Constructs	Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301	|NSP1 |NUP1 |NUP100 |NUP133 |NUP145 |NUP49 |NUP85
Function/Process Mutants/Phenotypes Strains/Constructs	Simos G, et al. (1996) Nuclear pore proteins are involved in the biogenesis of functional tRNA. EMBO J 15(9):2270-84	|LOS1 |NSP1 |NUP133 |NUP85 |PUS1 |PUS2
Protein-protein Interactions	Stutz F, et al. (1996) A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 Rev protein and RNA from the nucleus. Mol Cell Biol 16(12):7144-50	|NUP100 |NUP145 |NUP159 |NUP42 |NUP49 |NUP57
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP133 |NUP159 |NUP188 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Iovine MK, et al. (1995) The GLFG repetitive region of the nucleoporin Nup116p interacts with Kap95p, an essential yeast nuclear import factor. J Cell Biol 131(6 Pt 2):1699-713	|KAP95 |NUP100 |NUP145 |NUP49 |NUP57
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Powers MA, et al. (1995) Reconstituted nuclei depleted of a vertebrate GLFG nuclear pore protein, p97, import but are defective in nuclear growth and replication. J Cell Biol 128(5):721-36	|NUP145
Reviews	Schneiter R, et al. (1995) mRNA transport in yeast: time to reinvestigate the functions of the nucleolus. Mol Biol Cell 6(4):357-70	|MTR2 |NPL3 |NUP145 |NUP49 |RNA14
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein-Nucleic Acid Interactions	Fabre E, et al. (1994) Nup145p is required for nuclear export of mRNA and binds homopolymeric RNA in vitro via a novel conserved motif. Cell 78(2):275-89	|NSP1 |NUP100 |NUP145
Fungal Related Genes/Proteins Genetic Interactions	Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69	|NUP100 |NUP145 |NUP63
Cellular Location Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Wente SR and Blobel G (1993) A temperature-sensitive NUP116 null mutant forms a nuclear envelope seal over the yeast nuclear pore complex thereby blocking nucleocytoplasmic traffic. J Cell Biol 123(2):275-84
Cellular Location Fungal Related Genes/Proteins Mutants/Phenotypes Other Features Protein Sequence Features Strains/Constructs Techniques and Reagents	Wente SR, et al. (1992) A new family of yeast nuclear pore complex proteins. J Cell Biol 119(4):705-23	|NUP100 |NUP49
Cellular Location Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Wimmer C, et al. (1992) A new subclass of nucleoporins that functionally interact with nuclear pore protein NSP1. EMBO J 11(13):5051-61	|NSP1 |NUP49

Return to SGD

Send a Message to the SGD Curators