HOF1/YMR032W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 335297 to 337306
CDS: 335297 - 337306

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

HOF1 YMR032W CYK2 ORF, Verified S000004635

See Nomenclature Note.

Description
Bud neck-localized, SH3 domain-containing protein required for cytokinesis; regulates actomyosin ring dynamics and septin localization; interacts with the formins, Bni1p and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
cytoskeletal protein binding Lippincott J and Li R (1998) Dual function of Cyk2, a cdc15/PSTPIP family protein, in regulating actomyosin ring dynamics and septin distribution. J Cell Biol 143(7):1947-60
       IPI : Inferred from Physical Interaction
Assigned on 2001-01-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0132
Assigned on 2007-05-23 UniProtKB
Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cytokinesis Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85
       TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
mitosis GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0498
Assigned on 2007-05-23 UniProtKB
reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
response to DNA damage stimulus Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9
           IMP : Inferred from Mutant Phenotype
Assigned on 2006-04-06 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cellular bud neck contractile ring Blondel M, et al. (2005) Degradation of Hof1 by SCF(Grr1) is important for actomyosin contraction during cytokinesis in yeast. EMBO J 24(7):1440-52
         IDA : Inferred from Direct Assay
Assigned on 2005-03-30 SGD
cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0963
Assigned on 2009-06-29 UniProtKB
cytoskeleton GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0206
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0090
Assigned on 2009-05-06 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forHOF1/YMR032W for HOF1
1) Kamei T, et al. (1998) Interaction of Bnr1p with a novel Src homology 3 domain-containing Hof1p. Implication in cytokinesis in Saccharomyces cerevisiae. J Biol Chem 273(43):28341-5

2) Lippincott J and Li R (1998) Dual function of Cyk2, a cdc15/PSTPIP family protein, in regulating actomyosin ring dynamics and septin distribution. J Cell Biol 143(7):1947-60

3) Korinek WS, et al. (2000) Cyk3, a novel SH3-domain protein, affects cytokinesis in yeast. Curr Biol 10(15):947-50

4) Naqvi SN, et al. (2001) Vrp1p functions in both actomyosin ring-dependent and Hof1p-dependent pathways of cytokinesis. Traffic 2(3):189-201

5) Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for HOF1/YMR032W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for HOF1/YMR032W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSYSYEA

C-term QLLHQGL

Length(aa) 669

MW(Da) 76,206

pI 9.85

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.048

Codon Adaptation Index 0.127

Frequency of Optimal Codons 0.435

Hydropathicity of Protein -0.810

Aromaticity Score 0.069

10 20 30 40 50 | | | | | MSYSYEACFWDPNDNGVNILLGHISQGIRSCDSMILFFKQRSELEKDYAR RLGAITGKLDKDIGTNMDYGKLNETFNVVLSVEKARAQSHSKQSEILFRQ IYTDTKAFAANLQARYTTLSGKIERLRMDKFNKKKGCEVLQKKLQDAQIR FRDLQLNENNMIGAKRVEHNKRELLKWESNSQEYKVQLDVLKQEYKASQK FWIHEWAQLSCELQEMENARISFLQSKLQQFATSSMETYILEQTKMDMLT NHLNSFTAADEISTFSKENGTGRLKHKTSKGDMNSSANWAQMSSISTTSK KTESYMDNIRKLSSQLKETENKRKLASIDKYEKPLPSPEVTMATQFRNST PVIRNETKVVANPTLSLRSSPVQLQSNVDDSVLRQKPDKPRPIVGEEQLK PDEDSKNPDEKGLMVHKRNQSLSSPSESSSSNPTDFSHIKKRQSMESMTT SVSSMANSIDDSQRFAKSWNSSNRKRKSMSHLQVPSSASSRSDDGGRTPN SAHNLNEDDYNTRRDTSTSTILFKPPVAVRGTSRGHTHRQSMIMQDSSNP IEDALYEMERIQSSSKPGTKTGNIMDERGVVRDRGITVTLPIVTSEGFPV IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDR NHRIGLIPYNFIQLLHQGL*

Protein Structures from PDB: proteins of known structure with sequence similarity to HOF1/YMR032W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to HOF1 Homolog Source (per PDB) Protein Alignment: HOF1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2efl ( Chain: A)
Crystal structure of the efc domain of formin-binding protein 17
PDB_Info
PDB_Structure
Homo sapiens 0.004498 23 32 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
HOF1 SGD (2007) Information without a citation in SGD

Nomenclature History Notes
Date Note
2004-11-16 CDC15/YAR019C encodes a protein kinase involved in exit from mitosis. Do not confuse CDC15/YAR019C with pombe cdc15, which is similar to the cerevisiae HOF1/YMR032W gene.

Standard Name	Reference
HOF1	SGD (2007) Information without a citation in SGD

Date	Note
2004-11-16	CDC15/YAR019C encodes a protein kinase involved in exit from mitosis. Do not confuse CDC15/YAR019C with pombe cdc15, which is similar to the cerevisiae HOF1/YMR032W gene.

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YMR032W SGD Systematic Sequence

855048 NCBI: Gene ID

NP_013746.1 NCBI: RefSeq protein version ID

NP_013746.1 NCBI: RefSeq protein version ID

6323675 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YMR032W	SGD Systematic Sequence
855048	NCBI: Gene ID
NP_013746.1	NCBI: RefSeq protein version ID
NP_013746.1	NCBI: RefSeq protein version ID
6323675	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
Interactions
Topic Research Highlight Reference Contributor
Genetic Description: None
mutation for the interacting gene: deletion
mutation for this gene: deletion
is synthetic lethal with: myo1
with: myo1
Vallen EA, et al. (2000) Roles of Hof1p, Bni1p, Bnr1p, and myo1p in cytokinesis in Saccharomyces cerevisiae. Mol Biol Cell 11(2):593-611
Erfei Bi
2003-08-14

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
55 curated references; 0 references not yet curated
Fungal Related Genes/Proteins
Cote P, et al. (2009) Transcriptional analysis of the Candida albicans cell cycle. Mol Biol Cell 20(14):3363-73
       |ACE2 |APC1 |ASE1 |CDC14 |CDC20 |CDC27 |CDC28 |CDC5 |CDC6 |CHS1 |CHS3 |CLB4 |CSE4 |CTS1 |MORE
Mutants/Phenotypes
Strains/Constructs
Couplan E, et al. (2009) Polyunsaturated fatty acids inhibit PI3K activity in a yeast-based model system. Biotechnol J 4(8):1190-7
       |VPS34
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Fernandez-Ballester G, et al. (2009) Structure-based prediction of the Saccharomyces cerevisiae SH3-ligand interactions. J Mol Biol 388(4):902-16
       |ABP1 |BBC1 |BEM1 |BOI1 |BOI2 |BZZ1 |CYK3 |HSE1 |LSB1 |LSB3 |MYO3 |MYO5 |NBP2 |PEX13 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Jendretzki A, et al. (2009) Cyk3 acts in actomyosin ring independent cytokinesis by recruiting Inn1 to the yeast bud neck. Mol Genet Genomics 282(4):437-51
       |CYK3 |INN1 |IQG1 |MYO1
Fungal Related Genes/Proteins
Kaufmann A and Philippsen P (2009) Of bars and rings: Hof1-dependent cytokinesis in multiseptated hyphae of Ashbya gossypii. Mol Cell Biol 29(3):771-83
       |BUD3 |IQG1 |MYO1
Reviews
Lefebvre F, et al. (2009) Through its F-BAR and RhoGAP domains, Rgd1p acts in different polarized growth processes in budding yeast. Commun Integr Biol 2(2):120-2
       |BNR1 |LAS17 |RGD1 |RHO3 |RHO4 |VRP1
Reviews
Munn AL and Thanabalu T (2009) Verprolin: a cool set of actin-binding sites and some very HOT prolines. IUBMB Life 61(7):707-12
       |ACT1 |ARP2 |ARP3 |BNI1 |BNR1 |CDC42 |LAS17 |MYO5 |VRP1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Nishihama R, et al. (2009) Role of Inn1 and its interactions with Hof1 and Cyk3 in promoting cleavage furrow and septum formation in S. cerevisiae. J Cell Biol 185(6):995-1012
       |BNI1 |BNI5 |CDC12 |CDC14 |CDC5 |CHS2 |CYK3 |ELM1 |GIN4 |INN1 |IQG1 |MLC1 |MYO1 |PSA1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Sullivan DP, et al. (2009) Tritium suicide selection identifies proteins involved in the uptake and intracellular transport of sterols in Saccharomyces cerevisiae. Eukaryot Cell 8(2):161-9
     |ADA2 |AIM44 |AUS1 |BEM2 |COS10 |DCR2 |DET1 |ELF1 |ERR3 |MOT3 |NFS1 |PDR11 |PPZ2 |RAM1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Tessarz P, et al. (2009) The yeast AAA+ chaperone Hsp104 is part of a network that links the actin cytoskeleton with the inheritance of damaged proteins. Mol Cell Biol 29(13):3738-45
       |HSP104 |PEA2 |SPA2
Protein Sequence Features
Substrates/Ligands/Cofactors
Tonikian R, et al. (2009) Bayesian modeling of the yeast SH3 domain interactome predicts spatiotemporal dynamics of endocytosis proteins. PLoS Biol 7(10):e1000218
     |ABP1 |AIM21 |BBC1 |BEM1 |BOI1 |BOI2 |BSP1 |BUD14 |BZZ1 |CDC25 |CYK3 |FUS1 |HSE1 |LSB1 |MORE
Cellular Location
Protein Physical Properties
Strains/Constructs
Techniques and Reagents
Young BA, et al. (2009) Isolation and partial purification of the saccharomyces cerevisiae cytokinetic apparatus. Cell Motil Cytoskeleton
       |ACT1 |CDC11 |IQG1 |MLC2 |MOB1 |MYO1
Cellular Location
Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50
       |AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |MORE
Function/Process
Mutants/Phenotypes
Abe F and Minegishi H (2008) Global screening of genes essential for growth in high-pressure and cold environments: searching for basic adaptive strategies using a yeast deletion library. Genetics 178(2):851-72
       |ACO1 |AGP1 |AGP2 |AGP3 |AKR1 |ALP1 |ARD1 |ARG82 |ARO1 |ARO2 |ATP15 |AVL9 |BAP2 |BAP3 |MORE
Genetic Interactions
Federovitch CM, et al. (2008) Genetic and structural analysis of Hmg2p-induced endoplasmic reticulum remodeling in Saccharomyces cerevisiae. Mol Biol Cell 19(10):4506-20
       |BNI1 |BNR1 |CHO2 |ERG28 |ERV25 |HER1 |HER2 |HMG1 |HMG2 |HRD1 |KAR2 |NEM1 |OPI3 |PSD1 |MORE
Cellular Location
Computational analysis
Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004
       |AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Protein-protein Interactions
Sanchez-Diaz A, et al. (2008) Inn1 couples contraction of the actomyosin ring to membrane ingression during cytokinesis in budding yeast. Nat Cell Biol 10(4):395-406
       |INN1 |IQG1
Mutants/Phenotypes
Bicknell AA, et al. (2007) A novel role in cytokinesis reveals a housekeeping function for the unfolded protein response. J Cell Biol 177(6):1017-27
     |BNI1 |CHS2 |CYK3 |ERO1 |HAC1 |MLC2
Mutants/Phenotypes
Kramer RW, et al. (2007) Yeast functional genomic screens lead to identification of a role for a bacterial effector in innate immunity regulation. PLoS Pathog 3(2):e21
             |AFR1 |BMH1 |BNI1 |BNI4 |BRO1 |BUD22 |CCW12 |CDC10 |CDC26 |CNM67 |CWP1 |DAD3 |ECM33 |FIT2 |MORE
Mutants/Phenotypes
Strains/Constructs
Lockshon D, et al. (2007) The sensitivity of yeast mutants to oleic Acid implicates the peroxisome and other processes in membrane function. Genetics 175(1):77-91
       |ADO1 |ADR1 |AIM38 |AKR1 |ARP6 |ATG17 |AVL9 |BUD14 |BUD22 |BUD23 |BUD31 |CAR2 |CBS1 |CLA4 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Nam SC, et al. (2007) Phosphorylation-Dependent Septin Interaction of Bni5 is Important for Cytokinesis. J Microbiol 45(3):227-33
       |BNI5 |CDC11 |CDC12
Mutants/Phenotypes
Thevissen K, et al. (2007) Miconazole Induces Changes in Actin Cytoskeleton prior to Reactive Oxygen Species Induction in Yeast. J Biol Chem 282(30):21592-7
       |ARO1 |ARO2 |ARV1 |CBF1 |CDC50 |CLC1 |CNB1 |CTR1 |DRS2 |FYV6 |GCN5 |GCS1 |HFI1 |NGG1 |MORE
Cellular Location
Protein Processing/Modification/Regulation
Corbett M, et al. (2006) IQGAP and mitotic exit network (MEN) proteins are required for cytokinesis and re-polarization of the actin cytoskeleton in the budding yeast, Saccharomyces cerevisiae. Eur J Cell Biol 85(11):1201-15
       |ACT1 |CDC15 |DBF2 |DBF20 |IQG1 |TEM1
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gandhi M, et al. (2006) Four novel suppressors of gic1 gic2 and their roles in cytokinesis and polarized cell growth in Saccharomyces cerevisiae. Genetics 174(2):665-78
       |ACT1 |AXL2 |BNI1 |CDC3 |CLN2 |CYC8 |GIC1 |GIC2 |MLF3 |MSB1 |MSB2 |MYO1 |RSR1 |SKG6 |MORE
Fungal Related Genes/Proteins
Li WJ, et al. (2006) The F-box protein Grr1 regulates the stability of Ccn1, Cln3 and Hof1 and cell morphogenesis in Candida albicans. Mol Microbiol 62(1):212-26
     |ACT1 |CLN1 |CLN3 |GRR1
Fungal Related Genes/Proteins
Protein Sequence Features
Beltrao P and Serrano L (2005) Comparative genomics and disorder prediction identify biologically relevant SH3 protein interactions. PLoS Comput Biol 1(3):e26
         |ABP1 |BBC1 |BCK1 |BEM1 |BOI1 |BOI2 |BUD14 |BZZ1 |CDC25 |CYK3 |DNF1 |DNF2 |FUS1 |HSE1 |MORE
Cell Cycle Phase Involved
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Blondel M, et al. (2005) Degradation of Hof1 by SCF(Grr1) is important for actomyosin contraction during cytokinesis in yeast. EMBO J 24(7):1440-52
         |CDH1 |GRR1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Dyczkowski J and Vingron M (2005) Comparative analysis of cell cycle regulated genes in eukaryotes. Genome Inform 16(1):125-31
     |AAC1 |CDC45 |CPR1 |DBF20 |DSK2 |FKH1 |FKH2 |HHF1 |HHF2 |HHT1 |HHT2 |HTA1 |HTA2 |HTB1 |MORE
Cellular Location
Genetic Interactions
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Ren G, et al. (2005) Verprolin cytokinesis function mediated by the Hof one trap domain. Traffic 6(7):575-93
           |MYO3 |VRP1
Cell Cycle Phase Involved
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Dobbelaere J and Barral Y (2004) Spatial coordination of cytokinetic events by compartmentalization of the cell cortex. Science 305(5682):393-6
       |CDC12 |CDC3 |CHS2 |IQG1 |MYO1 |SEC3 |SPA2
DNA/RNA Sequence Features
Regulation of
Kreiman G (2004) Identification of sparsely distributed clusters of cis-regulatory elements in sets of co-expressed genes. Nucleic Acids Res 32(9):2889-900
                   |ACE2 |AIM20 |ALK1 |APC1 |BUD3 |BUD4 |BUD8 |CDC20 |CDC5 |CHS2 |CLB1 |CLB2 |HST3 |IQG1 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Norden C, et al. (2004) Dissection of septin actin interactions using actin overexpression in Saccharomyces cerevisiae. Mol Microbiol 53(2):469-83
       |ACT1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |CDC12 |CDC3 |MYO1 |SPA2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Goehring AS, et al. (2003) Synthetic lethal analysis implicates Ste20p, a p21-activated potein kinase, in polarisome activation. Mol Biol Cell 14(4):1501-16
         |ACT1 |APC9 |ASF1 |BCK1 |BEM1 |BEM2 |BEM4 |BNI1 |BUD6 |CDC3 |CHS3 |CHS5 |CHS6 |CHS7 |MORE
Mutants/Phenotypes
Regulatory Role
Griffith JL, et al. (2003) Functional genomics reveals relationships between the retrovirus-like Ty1 element and its host Saccharomyces cerevisiae. Genetics 164(3):867-79
           |APN1 |ARD1 |BEM1 |BUD30 |CBC2 |CTK1 |DBR1 |DOA4 |JNM1 |KCS1 |LSM1 |MCK1 |MFT1 |NAT1 |MORE
DNA/RNA Sequence Features
Tamada Y, et al. (2003) Estimating gene networks from gene expression data by combining Bayesian network model with promoter element detection. Bioinformatics 19 Suppl 2:II227-II236
           |ACE2 |ALK1 |ARG2 |BUD4 |CHA4 |CLB2 |GAL11 |REB1 |SUR7 |SWI5 |SWI6
Function/Process
Mutants/Phenotypes
Strains/Constructs
Begley TJ, et al. (2002) Damage recovery pathways in Saccharomyces cerevisiae revealed by genomic phenotyping and interactome mapping. Mol Cancer Res 1(2):103-12
         |AHC1 |ATG17 |CHZ1 |ESC2 |HDA1 |HFI1 |HHO1 |HST3 |HTZ1 |MSI1 |RTT107 |SAN1 |SGF29 |SHU1 |MORE
Mutants/Phenotypes
Strains/Constructs
Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9
           |AAT2 |APN1 |ARO1 |ARO7 |ASF1 |BDF1 |BUD25 |BUR2 |CAC2 |CCS1 |CDC40 |CDC50 |CHL1 |CIK1 |MORE
Non-Fungal Related Genes/Proteins
Reviews
Guertin DA, et al. (2002) Cytokinesis in eukaryotes. Microbiol Mol Biol Rev 66(2):155-78
         |BFA1 |BIR1 |BNI1 |BUB2 |CDC10 |CDC11 |CDC12 |CDC14 |CDC15 |CDC3 |CDC5 |CDH1 |DBF2 |DBF20 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lee PR, et al. (2002) Bni5p, a septin-interacting protein, is required for normal septin function and cytokinesis in Saccharomyces cerevisiae. Mol Cell Biol 22(19):6906-20
       |BNI5 |CDC10 |CDC11 |CDC12 |CDC3 |SHS1
Cell Cycle Phase Involved
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Strains/Constructs
Naqvi SN, et al. (2001) Vrp1p functions in both actomyosin ring-dependent and Hof1p-dependent pathways of cytokinesis. Traffic 2(3):189-201
       |VRP1
Regulation of
Song S and Lee KS (2001) A novel function of Saccharomyces cerevisiae CDC5 in cytokinesis. J Cell Biol 152(3):451-69
       |CDC11 |CDC12 |CDC5 |CLB2 |MYO1 |SWE1
Function/Process
Thanabalu T and Munn AL (2001) Functions of Vrp1p in cytokinesis and actin patches are distinct and neither requires a WH2/V domain. EMBO J 20(24):6979-89
       |ACT1 |LAS17 |VRP1
Reviews
Tolliday N, et al. (2001) Assembly and regulation of the cytokinetic apparatus in budding yeast. Curr Opin Microbiol 4(6):690-5
             |MYO1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Korinek WS, et al. (2000) Cyk3, a novel SH3-domain protein, affects cytokinesis in yeast. Curr Biol 10(15):947-50
       |ACT1 |CYK3 |IQG1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Lippincott J and Li R (2000) Involvement of PCH family proteins in cytokinesis and actin distribution. Microsc Res Tech 49(2):168-72
       |BZZ1
Cell Cycle Phase Involved
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Lippincott J and Li R (2000) Nuclear envelope fission is linked to cytokinesis in budding yeast. Exp Cell Res 260(2):277-83
       |IQG1 |SEC63
Reviews
Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85
       |ABP1 |ACT1 |AIP1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |AXL2 |BEM1 |BNI1 |BNI4 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Strains/Constructs
Vallen EA, et al. (2000) Roles of Hof1p, Bni1p, Bnr1p, and myo1p in cytokinesis in Saccharomyces cerevisiae. Mol Biol Cell 11(2):593-611
       |BNI1 |BNR1 |MYO1
Reviews
Hales KG, et al. (1999) Cytokinesis: an emerging unified theory for eukaryotes? Curr Opin Cell Biol 11(6):717-25
       |BIM1 |IQG1 |MYO1
Cellular Location
Function/Process
Protein-protein Interactions
Kikyo M, et al. (1999) An FH domain-containing Bnr1p is a multifunctional protein interacting with a variety of cytoskeletal proteins in Saccharomyces cerevisiae. Oncogene 18(50):7046-54
     |BNI1 |BNR1 |BUD6 |CDC10 |CDC11 |CDC12 |CDC3 |SMY1
Fungal Related Genes/Proteins
Jwa M and Song K (1998) Byr4, a dosage-dependent regulator of cytokinesis in S. pombe, interacts with a possible small GTPase pathway including Spg1 and Cdc16. Mol Cells 8(2):240-5
     |BUB2 |CDC5 |POL3 |TEM1
Cellular Location
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Kamei T, et al. (1998) Interaction of Bnr1p with a novel Src homology 3 domain-containing Hof1p. Implication in cytokinesis in Saccharomyces cerevisiae. J Biol Chem 273(43):28341-5
       |BNI1 |BNR1 |PFY1 |RHO4
Cell Cycle Phase Involved
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Lippincott J and Li R (1998) Dual function of Cyk2, a cdc15/PSTPIP family protein, in regulating actomyosin ring dynamics and septin distribution. J Cell Biol 143(7):1947-60
       |CDC10 |CDC11 |CDC12 |CDC15 |CDC3 |MYO1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Plomann M, et al. (1998) PACSIN, a brain protein that is upregulated upon differentiation into neuronal cells. Eur J Biochem 256(1):201-11
       |BZZ1
Fungal Related Genes/Proteins
Fankhauser C, et al. (1995) The S. pombe cdc15 gene is a key element in the reorganization of F-actin at mitosis. Cell 82(3):435-44

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.