- Site Map |
- Search Options |
- Help |
- Home |
| 
UBC7/YMR022W Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
ChrXIII: 318679 to 319176
CDS: 318679 - 319176Click on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| UBC7 | YMR022W | QRI8 | ORF, Verified | S000004624 | ||||
| Description | ||||||||
| Ubiquitin conjugating enzyme, involved in the ER-associated protein degradation pathway; requires Cue1p for recruitment to the ER membrane; proposed to be involved in chromatin assembly | ||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No pathways available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No summary paragraph available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for UBC7/YMR022W | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for UBC7/YMR022W | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MSKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYA
DGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDP
NMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPE
FERQVKLSILKSLGF*
| ||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| Standard Name | Reference |
|---|---|
| UBC7 | Jungmann J, et al. (1993) Resistance to cadmium mediated by ubiquitin-dependent proteolysis. Nature 361(6410):369-71  |
| Alias Name(s) | Reference |
|---|---|
| QRI8 | Vassal A, et al. (1992) QRI8, a novel ubiquitin-conjugating enzyme in Saccharomyces cerevisiae. Biochim Biophys Acta 1132(2):211-3 |
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YMR022W | SGD Systematic Sequence |
| 855036 | NCBI: Gene ID |
| NP_013735.1 | NCBI: RefSeq protein version ID |
| NP_013735.1 | NCBI: RefSeq protein version ID |
| 6323664 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map | |||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 94 curated references; 0 references not yet curated | |||
| Mutants/Phenotypes Regulatory Role Strains/Constructs | Adle DJ, et al. (2009) Cadmium-mediated rescue from ER-associated degradation induces expression of its exporter. Proc Natl Acad Sci U S A 106(25):10189-94  | |CDC48 |CUE1 |HRD1 |PCA1 |SEC23 |SSM4 |UBC6 |YOR1 | ||||
| Mutants/Phenotypes Strains/Constructs | Cardona F, et al. (2009) Ubiquitin ligase Rsp5p is involved in the gene expression changes during nutrient limitation in Saccharomyces cerevisiae. Yeast 26(1):1-15 | |BUL1 |BUL2 |DOA4 |RAD6 |RSP5 |SPI1 |UBC1 |UBI4 |UBP14 |UBP6 | ||||
| Mutants/Phenotypes Strains/Constructs | Garza RM, et al. (2009) In vitro analysis of Hrd1p-mediated retrotranslocation of its multispanning membrane substrate 3-hydroxy-3-methylglutaryl (HMG)-CoA reductase. J Biol Chem 284(22):14710-22 | |CDC48 |DER1 |DFM1 |DSK2 |HMG2 |HRD1 |HRD3 |RAD23 |RPN1 |UBX2 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Jonikas MC, et al. (2009) Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum. Science 323(5922):1693-7 | |AIM27 |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |CUE1 |DER1 |DIE2 |EMC1 |EMC2 |EMC4 |EMC6 |MORE | ||||
| Non-Fungal Related Genes/Proteins Protein Physical Properties | Li W, et al. (2009) Mechanistic insights into active site-associated polyubiquitination by the ubiquitin-conjugating enzyme Ube2g2. Proc Natl Acad Sci U S A 106(10):3722-7 | |||||
| Mutants/Phenotypes | Lundh F, et al. (2009) Molecular mechanisms controlling phosphate-induced downregulation of the yeast Pho84 phosphate transporter. Biochemistry 48(21):4497-505 | |PHO84 |RAD6 |TPK1 |TPK2 |TPK3 |UBC1 |UBC4 |UBC5 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Metzger MB and Michaelis S (2009) Analysis of quality control substrates in distinct cellular compartments reveals a unique role for Rpn4p in tolerating misfolded membrane proteins. Mol Biol Cell 20(3):1006-19 | |ADE17 |ALF1 |CCT3 |CIK1 |DGK1 |ECM29 |GET3 |HAC1 |HRD1 |IDH1 |ITR1 |KAR2 |MAG1 |MIA40 |MORE | ||||
| Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins | Michelle C, et al. (2009) What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor? J Mol Evol 68(6):616-28 | |CDC34 |PEX4 |RAD6 |UBC1 |UBC11 |UBC12 |UBC13 |UBC4 |UBC5 |UBC6 |UBC8 |UBC9 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Scrimale T, et al. (2009) The Unfolded Protein Response Is Induced by the Cell Wall Integrity Mitogen-activated Protein Kinase Signaling Cascade and Is Required for Cell Wall Integrity in Saccharomyces cerevisiae. Mol Biol Cell 20(1):164-75 | |GAS1 |HRD1 |IRE1 |MBP1 |MID2 |SLG1 |SLT2 |SSM4 |STB1 |SWI6 | ||||
| Genetic Interactions | Wang Z and Prelich G (2009) Quality control of a transcriptional regulator by SUMO-targeted degradation. Mol Cell Biol 29(7):1694-706 | |MMS2 |MOT1 |NFI1 |PEX4 |RAD6 |RCO1 |SET2 |SIZ1 |SLX5 |SLX8 |SMT3 |SPT16 |SPT20 |SPT6 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Xu P, et al. (2009) Quantitative proteomics reveals the function of unconventional ubiquitin chains in proteasomal degradation. Cell 137(1):133-45  | |DOA4 |DSK2 |HRD1 |IRC25 |IRE1 |POC4 |PRE9 |RAD23 |RBL2 |RPL40A |RPL40B |RPS31 |SEM1 |SSM4 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Duennwald ML and Lindquist S (2008) Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity. Genes Dev 22(23):3308-3319 | |CDC48 |CUE1 |HAC1 |IRE1 |NPL4 |OLE1 |PMR1 |PRC1 |PRE1 |PRE2 |PRE9 |RAD6 |RPN2 |SEC22 |MORE | ||||
| Reviews | Hochstrasser M, et al. (2008) Molecular genetics of the ubiquitin-proteasome system: lessons from yeast. Ernst Schering Found Symp Proc(1):41-66 | |ADD66 |CBF2 |IRC25 |MATALPHA2 |MPS2 |PBA1 |PMA1 |POC4 |PRE6 |PRE9 |PUP2 |RPN5 |RPT5 |SSM4 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Hwang GW, et al. (2008) The ubiquitin-conjugating enzymes, Ubc4 and Cdc34, mediate cadmium resistance in budding yeast through different mechanisms. Life Sci 82(23-24):1182-5 | |CDC34 |MET17 |UBC4 |UBC5 | ||||
| Protein Sequence Features | Lee I and Schindelin H (2008) Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes. Cell 134(2):268-78 | |CDC34 |RAD6 |UBA1 |UBC1 |UBC12 |UBC13 |UBC4 |UBC5 |UBC9 | ||||
| Mutants/Phenotypes Non-Fungal Related Genes/Proteins | Li F, et al. (2008) Thiopurine S-methyltransferase pharmacogenetics: autophagy as a mechanism for variant allozyme degradation. Pharmacogenet Genomics 18(12):1083-94 | |ADY3 |APE3 |ATG10 |ATG12 |ATG3 |ATG5 |ATG7 |ATG8 |BUD14 |CNE1 |CPS1 |CUE1 |ERP1 |ERP2 |MORE | ||||
| Strains/Constructs | Loring GL, et al. (2008) Yeast Chfr homologs retard cell cycle at G1 and G2/M via Ubc4 and Ubc13/Mms2-dependent ubiquitination. Cell Cycle 7(1):96-105 | |DMA1 |DMA2 |MMS2 |PEX4 |RAD6 |UBC11 |UBC13 |UBC4 |UBC5 |UBC8 | ||||
| Mutants/Phenotypes Strains/Constructs | Medicherla B and Goldberg AL (2008) Heat shock and oxygen radicals stimulate ubiquitin-dependent degradation mainly of newly synthesized proteins. J Cell Biol 182(4):663-73 | |CDC48 |NPL4 |RPN10 |SOD1 |SOD2 |UBC4 |UBC5 |UFD1 |UFD4 | ||||
| Function/Process Mutants/Phenotypes Substrates/Ligands/Cofactors | Metzger MB, et al. (2008) Degradation of a Cytosolic Protein Requires Endoplasmic Reticulum-associated Degradation Machinery. J Biol Chem 283(47):32302-16 | |CDC48 |CUE1 |HLJ1 |NPL4 |SSA1 |SSM4 |UBC4 |UBC5 |UBC6 |UFD1 |URA3 |YDJ1 | ||||
| Alias Mutants/Phenotypes Strains/Constructs | Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67 | |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE | ||||
| Genetic Interactions Strains/Constructs | Takeuchi M, et al. (2008) Saccharomyces cerevisiae Rot1 Is an Essential Molecular Chaperone in the Endoplasmic Reticulum. Mol Biol Cell 19(8):3514-25 | |DRS2 |GUP1 |KAR2 |KRE5 |KRE6 |ROT1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Braun S and Jentsch S (2007) SM-protein-controlled ER-associated degradation discriminates between different SNAREs. EMBO Rep 8(12):1176-82 | |CDC48 |SED5 |SLY1 |UBC6 |UFD1 |UFE1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Kota J, et al. (2007) Membrane chaperone Shr3 assists in folding amino acid permeases preventing precocious ERAD. J Cell Biol 176(5):617-28 | |AGP1 |GAP1 |GNP1 |HRD1 |PEP4 |SHR3 |SSM4 |UBC6 | ||||
| Genetic Interactions Mutants/Phenotypes | Mazon MJ, et al. (2007) Efficient degradation of misfolded mutant Pma1 by endoplasmic reticulum-associated degradation requires Atg19 and the Cvt/autophagy pathway. Mol Microbiol 63(4):1069-1077 | |ATG19 |CUE1 |DER1 |HRD1 |HRD3 |NPL4 |PEP4 |PMA1 |PRE1 |PRE2 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Pagant S, et al. (2007) Inhibiting endoplasmic reticulum (ER)-associated degradation of misfolded Yor1p does not permit ER export despite the presence of a diacidic sorting signal. Mol Biol Cell 18(9):3398-413 | |HLJ1 |HRD1 |HSC82 |HSP82 |SEC24 |SSM4 |UBX2 |YDJ1 |YOR1 | ||||
| Mutants/Phenotypes | Platta HW, et al. (2007) Ubiquitination of the peroxisomal import receptor Pex5p is required for its recycling. J Cell Biol 177(2):197-204 | |PEX22 |PEX4 |PEX5 |RAD6 |UBC1 |UBC11 |UBC13 |UBC4 |UBC5 |UBC6 |UBC8 | ||||
| Alias Cellular Location Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions | Ravid T and Hochstrasser M (2007) Autoregulation of an E2 enzyme by ubiquitin-chain assembly on its catalytic residue. Nat Cell Biol 9(4):422-7 | |CUE1 |UFD4 | ||||
| Strains/Constructs | Rodrigo-Brenni MC and Morgan DO (2007) Sequential E2s Drive Polyubiquitin Chain Assembly on APC Targets. Cell 130(1):127-39 | |CDC34 |PEX4 |RAD6 |UBC1 |UBC11 |UBC12 |UBC13 |UBC4 |UBC5 |UBC6 |UBC8 |UBC9 | ||||
| DNA/RNA Sequence Features | Steigele S, et al. (2007) Comparative analysis of structured RNAs in S. cerevisiae indicates a multitude of different functions. BMC Biol 5:25 | |AIM5 |ALR1 |AMA1 |ARC40 |ARG1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ASR1 |ATP2 |BMH1 |BMH2 |BRP1 |MORE | ||||
| Non-Fungal Related Genes/Proteins Protein/Nucleic Acid Structure | Arai R, et al. (2006) Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7). Acta Crystallogr Sect F Struct Biol Cryst Commun 62(Pt 4):330-4 | |||||
| Reviews | Boyce M and Yuan J (2006) Cellular response to endoplasmic reticulum stress: a matter of life or death. Cell Death Differ 13(3):363-73 | |CDC48 |CUE1 |DER1 |GCN2 |GCN4 |HAC1 |HRD1 |HRD3 |IRE1 |KAR2 |PDI1 |SEC61 |UBC1 |UBC6 | ||||
| Protein-protein Interactions | Carvalho P, et al. (2006) Distinct ubiquitin-ligase complexes define convergent pathways for the degradation of ER proteins. Cell 126(2):361-73 | |CDC48 |CUE1 |DER1 |HRD1 |HRD3 |IRE1 |NPL4 |SSM4 |UBX2 |USA1 |YOS9 | ||||
| Non-Fungal Related Genes/Proteins | Flierman D, et al. (2006) E2-25K mediates US11-triggered retro-translocation of MHC class I heavy chains in a permeabilized cell system. Proc Natl Acad Sci U S A 103(31):11589-94 | |||||
| Mutants/Phenotypes | Heiligenstein S, et al. (2006) Retrotranslocation of a viral A/B toxin from the yeast endoplasmic reticulum is independent of ubiquitination and ERAD. EMBO J 25(20):4717-27 | |CDC48 |DSK2 |HRD1 |JEM1 |KAR2 |NPL4 |PDI1 |PMR1 |RAD23 |RSP5 |SCJ1 |SPF1 |UBC1 |UBC4 |MORE | ||||
| Mutants/Phenotypes | Laney JD, et al. (2006) The short-lived Matalpha2 transcriptional repressor is protected from degradation in vivo by interactions with its corepressors Tup1 and Ssn6. Mol Cell Biol 26(1):371-80 | |CYC8 |MATALPHA2 |TUP1 |UBC6 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Liao M, et al. (2006) Endoplasmic reticulum-associated degradation of cytochrome P450 CYP3A4 in Saccharomyces cerevisiae: further characterization of cellular participants and structural determinants. Mol Pharmacol 69(6):1897-904 | |CDC48 |CUE1 |HRD1 |HRD3 |NPL4 |PEP4 |RPN1 |RSP5 |SSM4 |UBC6 |UFD1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Loertscher J, et al. (2006) Endoplasmic reticulum-associated degradation is required for cold adaptation and regulation of sterol biosynthesis in the yeast Saccharomyces cerevisiae. Eukaryot Cell 5(4):712-22 | |CUE1 |HMG1 |HMG2 |PRE1 |PRE2 |SSM4 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs | Arnason TG, et al. (2005) Novel interaction between Apc5p and Rsp5p in an intracellular signaling pathway in Saccharomyces cerevisiae. Eukaryot Cell 4(1):134-46 | |APC5 |CDC34 |CDC53 |RSP5 |SIC1 | ||||
| Alias Mutants/Phenotypes | Chuang SM and Madura K (2005) Saccharomyces cerevisiae Ub-conjugating enzyme Ubc4 binds the proteasome in the presence of translationally damaged proteins. Genetics 171(4):1477-84 | |RPT1 |RPT4 |RPT6 |UBC1 |UBC4 |UBC5 |UBC6 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Kiel JA, et al. (2005) Ubiquitination of the peroxisomal targeting signal type 1 receptor, Pex5p, suggests the presence of a quality control mechanism during peroxisomal matrix protein import. J Biol Chem 280(3):1921-30 | |PEX1 |PEX10 |PEX11 |PEX12 |PEX13 |PEX14 |PEX15 |PEX17 |PEX18 |PEX19 |PEX2 |PEX21 |PEX22 |PEX3 |MORE | ||||
| Fungal Related Genes/Proteins Protein Sequence Features | Catic A, et al. (2004) Preferred in vivo ubiquitination sites. Bioinformatics 20(18):3302-7 | |ACS2 |AKL1 |CDC34 |CDC48 |CHD1 |CSR2 |CTR9 |ELP3 |ENA5 |EXO84 |GAP1 |GDH1 |GPA1 |GSC2 |MORE | ||||
| Non-Fungal Related Genes/Proteins | Kikkert M, et al. (2004) Human HRD1 is an E3 ubiquitin ligase involved in degradation of proteins from the endoplasmic reticulum. J Biol Chem 279(5):3525-34 | |HRD1 | ||||
| Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins | Nameki N, et al. (2004) Solution structure of the RWD domain of the mouse GCN2 protein. Protein Sci 13(8):2089-100 | |GCN2 |MMS2 |UBC13 | ||||
| Genetic Interactions Strains/Constructs | Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9   | |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Hitchcock AL, et al. (2003) A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery. Proc Natl Acad Sci U S A 100(22):12735-40 | |NPL4 | ||||
| Reviews | Kostova Z and Wolf DH (2003) For whom the bell tolls: protein quality control of the endoplasmic reticulum and the ubiquitin-proteasome connection. EMBO J 22(10):2309-17 | |CDC48 |HRD3 |IRE1 |KAR2 |MNL1 |MNS1 |SEC61 | ||||
| Mutants/Phenotypes Strains/Constructs | Kushner DB, et al. (2003) Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Proc Natl Acad Sci U S A 100(26):15764-9 | |ACB1 |ALF1 |AML1 |BRO1 |BUB1 |BUD26 |BUD31 |CBC2 |CDC50 |DBR1 |DED1 |DHH1 |DOA1 |DOA4 |MORE | ||||
| Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs | Sato N, et al. (2003) Phosphorelay-regulated degradation of the yeast Ssk1p response regulator by the ubiquitin-proteasome system. Mol Cell Biol 23(18):6662-71 | |SSK1 |YPD1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Taxis C, et al. (2003) Use of modular substrates demonstrates mechanistic diversity and reveals differences in chaperone requirement of ERAD. J Biol Chem 278(38):35903-13 | |CDC48 |CWC23 |DER1 |HLJ1 |HRD1 |HRD3 |HSP104 |JID1 |KAR2 |NPL4 |SSA1 |SSA2 |SSA3 |SSA4 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Wang Q and Chang A (2003) Substrate recognition in ER-associated degradation mediated by Eps1, a member of the protein disulfide isomerase family. EMBO J 22(15):3792-802 | |CDC48 |EPS1 |PMA1 |SSM4 |UBC6 | ||||
| Mutants/Phenotypes Strains/Constructs | Wang Y, et al. (2003) Regulation of Ste7 ubiquitination by Ste11 phosphorylation and the Skp1-Cullin-F-box complex. J Biol Chem 278(25):22284-9 | |CDC28 |CDC34 |CDC53 |FAR1 |FUS3 |KSS1 |PEX4 |RAD6 |SKP1 |STE11 |STE5 |STE7 |UBC1 |UBC11 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Wright R, et al. (2003) Parallel analysis of tagged deletion mutants efficiently identifies genes involved in endoplasmic reticulum biogenesis. Yeast 20(10):881-92 | |HMG1 |SWC3 | ||||
| Alias Mutants/Phenotypes Strains/Constructs | Botero D, et al. (2002) Ubc6p and ubc7p are required for normal and substrate-induced endoplasmic reticulum-associated degradation of the human selenoprotein type 2 iodothyronine monodeiodinase. Mol Endocrinol 16(9):1999-2007 | |UBC1 |UBC6 | ||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Furuchi T, et al. (2002) Overexpression of the ubiquitin-conjugating enzyme Cdc34 confers resistance to methylmercury in Saccharomyces cerevisiae. Mol Pharmacol 61(4):738-41 | |CDC34 |UBC4 | ||||
| Alias Function/Process Substrates/Ligands/Cofactors | Haynes CM, et al. (2002) An HRD/DER-independent ER quality control mechanism involves Rsp5p-dependent ubiquitination and ER-Golgi transport. J Cell Biol 158(1):91-101 | |DER1 |HRD1 |HRD3 |IRE1 |RSP5 |SEC61 | ||||
| Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Substrates/Ligands/Cofactors | McBratney S and Winey M (2002) Mutant membrane protein of the budding yeast spindle pole body is targeted to the endoplasmic reticulum degradation pathway. Genetics 162(2):567-78 | |CUE1 |HRD1 |MPS2 |NDC1 |UBC6 | ||||
| Alias Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors | Bays NW, et al. (2001) Hrd1p/Der3p is a membrane-anchored ubiquitin ligase required for ER-associated degradation. Nat Cell Biol 3(1):24-9 | |HRD1 |UBC1 |UBC6 | ||||
| Alias Function/Process | Deak PM and Wolf DH (2001) Membrane topology and function of Der3/Hrd1p as a ubiquitin-protein ligase (E3) involved in endoplasmic reticulum degradation. J Biol Chem 276(14):10663-9 | |HRD1 |SEC61 | ||||
| Alias Cellular Location Function/Process Protein-protein Interactions Regulatory Role Substrates/Ligands/Cofactors | Gardner RG, et al. (2001) In vivo action of the HRD ubiquitin ligase complex: mechanisms of endoplasmic reticulum quality control and sterol regulation. Mol Cell Biol 21(13):4276-91 | |CUE1 |HMG1 |HMG2 |HRD1 |HRD3 |RPN1 | ||||
| Alias Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Murray BP and Correia MA (2001) Ubiquitin-dependent 26S proteasomal pathway: a role in the degradation of native human liver CYP3A4 expressed in Saccharomyces cerevisiae? Arch Biochem Biophys 393(1):106-16 | |HMG2 |HRD1 |HRD3 |PEP4 |RPN1 |SEC61 |SEC63 |UBC6 | ||||
| Function/Process Fungal Related Genes/Proteins | Swanson R, et al. (2001) A conserved ubiquitin ligase of the nuclear envelope/endoplasmic reticulum that functions in both ER-associated and Matalpha2 repressor degradation. Genes Dev 15(20):2660-74 | |HMLALPHA2 |HRD1 |MATALPHA2 |SSM4 |UBC6 | ||||
| Non-Fungal Related Genes/Proteins | Tiwari S and Weissman AM (2001) Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s). J Biol Chem 276(19):16193-200 | |UBC6 | ||||
| Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Walter J, et al. (2001) Sec61p-independent degradation of the tail-anchored ER membrane protein Ubc6p. EMBO J 20(12):3124-31 | |CUE1 |DER1 |HRD1 |HRD3 |SEC61 |UBC1 |UBC6 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Zhang Y, et al. (2001) Hsp70 molecular chaperone facilitates endoplasmic reticulum-associated protein degradation of cystic fibrosis transmembrane conductance regulator in yeast. Mol Biol Cell 12(5):1303-14 | |KAR2 |SSA1 |SSA2 |SSA3 |SSA4 |UBC6 | ||||
| Alias Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs | Cronin SR, et al. (2000) Regulation of HMG-CoA reductase degradation requires the P-type ATPase Cod1p/Spf1p. J Cell Biol 148(5):915-24 | |HMG1 |HMG2 |HRD1 |PMR1 |SPF1 |YPK9 | ||||
| Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Friedlander R, et al. (2000) A regulatory link between ER-associated protein degradation and the unfolded-protein response. Nat Cell Biol 2(7):379-84 | |CUE1 |HAC1 |HRD1 |IRE1 |PRC1 |UBC1 | ||||
| Alias Cellular Location Function/Process | Gilon T, et al. (2000) Degradation signals recognized by the Ubc6p-Ubc7p ubiquitin-conjugating enzyme pair. Mol Cell Biol 20(19):7214-9 | |CUE1 |HRD1 |SEC61 |UBC6 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Lenk U and Sommer T (2000) Ubiquitin-mediated proteolysis of a short-lived regulatory protein depends on its cellular localization. J Biol Chem 275(50):39403-10 | |CUE1 |MATALPHA2 |UBC6 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Ng DT, et al. (2000) The unfolded protein response regulates multiple aspects of secretory and membrane protein biogenesis and endoplasmic reticulum quality control. J Cell Biol 150(1):77-88 | |GAS1 |GPI10 |HAC1 |IRE1 |KAR2 |LHS1 |MCD4 |PER1 |PRC1 |RFT1 |RPN4 |SEC61 | ||||
| Non-Fungal Related Genes/Proteins | Orgad S, et al. (2000) courtless, the Drosophila UBC7 homolog, is involved in male courtship behavior and spermatogenesis. Genetics 155(3):1267-80 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Wilhovsky S, et al. (2000) HRD gene dependence of endoplasmic reticulum-associated degradation. Mol Biol Cell 11(5):1697-708 | |HRD1 |HRD3 |UBC6 | ||||
| Cross-species Expression Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Amshoff C, et al. (1999) Cycloheximide, a new tool to dissect specific steps in ER-associated degradation of different substrates. Biol Chem 380(6):669-77 | |DER1 |KAR2 |UBC6 | ||||
| Reviews | Laney JD and Hochstrasser M (1999) Substrate targeting in the ubiquitin system. Cell 97(4):427-30 | |RSP5 |UBC6 | ||||
| Non-Fungal Related Genes/Proteins | Lin H and Wing SS (1999) Identification of rabbit reticulocyte E217K as a UBC7 homologue and functional characterization of its core domain loop. J Biol Chem 274(21):14685-91 | |||||
| Alias Function/Process | Plemper RK and Wolf DH (1999) Endoplasmic reticulum degradation. Reverse protein transport and its end in the proteasome. Mol Biol Rep 26(1-2):125-30 | |DER1 |HRD1 |HRD3 |KAR2 |PDR5 |PRC1 |SEC61 |UBC6 | ||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs | Bordallo J, et al. (1998) Der3p/Hrd1p is required for endoplasmic reticulum-associated degradation of misfolded lumenal and integral membrane proteins. Mol Biol Cell 9(1):209-22 | |HRD1 |PRC1 |SEC61 |UBC6 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Galan JM, et al. (1998) 'ER degradation' of a mutant yeast plasma membrane protein by the ubiquitin-proteasome pathway. FASEB J 12(3):315-23 | |FUR4 |RSP5 |UBC6 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Gilon T, et al. (1998) Degradation signals for ubiquitin system proteolysis in Saccharomyces cerevisiae. EMBO J 17(10):2759-66 | |UBC6 |URA3 | ||||
| Non-Fungal Related Genes/Proteins | Katsanis N and Fisher EM (1998) Identification, expression, and chromosomal localization of ubiquitin conjugating enzyme 7 (UBE2G2), a human homologue of the Saccharomyces cerevisiae ubc7 gene. Genomics 51(1):128-31 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Kowalski JM, et al. (1998) Protein folding stability can determine the efficiency of escape from endoplasmic reticulum quality control. J Biol Chem 273(31):19453-8 | |DER1 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Sears C, et al. (1998) NF-kappa B p105 processing via the ubiquitin-proteasome pathway. J Biol Chem 273(3):1409-19 | |CDC34 |DOA4 |PEX4 |PRE1 |RAD6 |RPT1 |RPT2 |RPT3 |RPT5 |RPT6 |UBC1 |UBC11 |UBC4 |UBC5 |MORE | ||||
| Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs | Biederer T, et al. (1997) Role of Cue1p in ubiquitination and degradation at the ER surface. Science 278(5344):1806-9 | |CUE1 |SEC61 |UBC6 | ||||
| Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure | Cook WJ, et al. (1997) Crystal structure of a class I ubiquitin conjugating enzyme (Ubc7) from Saccharomyces cerevisiae at 2.9 angstroms resolution. Biochemistry 36(7):1621-7 | |UBC1 |UBC4 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Hampton RY and Bhakta H (1997) Ubiquitin-mediated regulation of 3-hydroxy-3-methylglutaryl-CoA reductase. Proc Natl Acad Sci U S A 94(24):12944-8 | |HMG1 |HMG2 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Kopski KM and Huffaker TC (1997) Suppressors of the ndc10-2 mutation: a role for the ubiquitin system in Saccharomyces cerevisiae kinetochore function. Genetics 147(2):409-20 | |CBF2 |CDC34 |CUE1 |SSM4 |UBC6 | ||||
| Reviews | Riezman H (1997) The ins and outs of protein translocation. Science 278(5344):1728-9 | |CUE1 |KAR2 |SEC61 |SEC63 |UBC6 | ||||
| Reviews | Sommer T and Wolf DH (1997) Endoplasmic reticulum degradation: reverse protein flow of no return. FASEB J 11(14):1227-33 | |CUE1 |DER1 |HRD1 |HRD3 |KAR2 |SEC61 |SEC63 |UBC6 | ||||
| Alias Cellular Location Function/Process Substrates/Ligands/Cofactors | Biederer T, et al. (1996) Degradation of subunits of the Sec61p complex, an integral component of the ER membrane, by the ubiquitin-proteasome pathway. EMBO J 15(9):2069-76 | |SBH1 |SSS1 |UBC6 | ||||
| Alias Cellular Location Function/Process Substrates/Ligands/Cofactors | Hiller MM, et al. (1996) ER degradation of a misfolded luminal protein by the cytosolic ubiquitin-proteasome pathway. Science 273(5282):1725-8 | |PRC1 |UBC6 | ||||
| Alias Function/Process Protein Physical Properties Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Yamazaki RK and Chau V (1996) Bacterial expression of the Saccharomyces cerevisiae ubiquitin-conjugating enzyme Ubc7. Protein Expr Purif 7(1):122-7 | |||||
| Alias Function/Process Protein-protein Interactions Substrates/Ligands/Cofactors | Chen P, et al. (1993) Multiple ubiquitin-conjugating enzymes participate in the in vivo degradation of the yeast MAT alpha 2 repressor. Cell 74(2):357-69 | |HMLALPHA2 |MATALPHA2 |UBC4 |UBC5 |UBC6 | ||||
| Alias Mutants/Phenotypes Strains/Constructs Transcription | Jungmann J, et al. (1993) Resistance to cadmium mediated by ubiquitin-dependent proteolysis. Nature 361(6410):369-71 | |||||
| DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Strains/Constructs | Vassal A, et al. (1992) QRI8, a novel ubiquitin-conjugating enzyme in Saccharomyces cerevisiae. Biochim Biophys Acta 1132(2):211-3 | |||||
| Reviews | Finley D and Chau V (1991) Ubiquitination. Annu Rev Cell Biol 7:25-69 | |PEX4 | ||||
 Return to SGD |
