BUD22/YMR014W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 298867 to 300426
CDS: 298867 - 300426

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD22 YMR014W ORF, Verified S000004616

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2001-02-13. Gene name expires on 2002-02-13.
Description
Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-09-25 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
rRNA processing Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
nucleolus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
             RCA : Reviewed Computational Analysis
Assigned on 2009-09-03 YeastFunc
nucleus Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IDA : Inferred from Direct Assay
Assigned on 2002-10-10 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0191
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD22/YMR014W for BUD22
1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD22/YMR014W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD22/YMR014W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MPSESSV

C-term GKKIKFD

Length(aa) 519

MW(Da) 60,054

pI 9.51

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.062

Codon Adaptation Index 0.161

Frequency of Optimal Codons 0.455

Hydropathicity of Protein -1.279

Aromaticity Score 0.066

10 20 30 40 50 | | | | | MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKK IEKLLNSLELKTLDKELDESYSKLLNNKIHYYETHLSKCIKEQIQKISKK NSSKVKDAQKNKSPSIDIEKMLATQLSLDDLALFMTRFRLIKILHQRIKQ KSKKIEGDTNNKTWLNNNDYSGYINDKTSKWNPSNIWNEVITKLPSCEKL NALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAREKTANANQTH SNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEYEGMLG SSGDEGEGGGYLNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRR KKPKLHNLPELMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQ MSNEPKRKNRRGQRARRKIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYE ARVAKREAKAASLEASRSREREDRRTETNNKKEKESASTGEEHPSWIAKR LAEEKLQKAKFEGKKIKFD*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD22/YMR014W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
BUD22 2001-08-13 Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Standard Name	Date Standardized	Reference
BUD22	2001-08-13	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YMR014W SGD Systematic Sequence

855028 NCBI: Gene ID

NP_013727.1 NCBI: RefSeq protein version ID

NP_013727.1 NCBI: RefSeq protein version ID

6323656 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YMR014W	SGD Systematic Sequence
855028	NCBI: Gene ID
NP_013727.1	NCBI: RefSeq protein version ID
NP_013727.1	NCBI: RefSeq protein version ID
6323656	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
10 curated references; 0 references not yet curated
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Li Z, et al. (2009) Rational extension of the ribosome biogenesis pathway using network-guided genetics. PLoS Biol 7(10):e1000213
           |AFG2 |ASC1 |BCP1 |BFR2 |BUD23 |DED1 |EAP1 |ENO1 |ENP2 |FCF1 |FCF2 |FUN12 |HAS1 |JIP5 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50
       |AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD3 |BUD4 |CDC10 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Mutants/Phenotypes
Kramer RW, et al. (2007) Yeast functional genomic screens lead to identification of a role for a bacterial effector in innate immunity regulation. PLoS Pathog 3(2):e21
             |AFR1 |BMH1 |BNI1 |BNI4 |BRO1 |CCW12 |CDC10 |CDC26 |CNM67 |CWP1 |DAD3 |ECM33 |FIT2 |FIT3 |MORE
Mutants/Phenotypes
Strains/Constructs
Lockshon D, et al. (2007) The sensitivity of yeast mutants to oleic Acid implicates the peroxisome and other processes in membrane function. Genetics 175(1):77-91
       |ADO1 |ADR1 |AIM38 |AKR1 |ARP6 |ATG17 |AVL9 |BUD14 |BUD23 |BUD31 |CAR2 |CBS1 |CLA4 |CTF8 |MORE
Mutants/Phenotypes
Xia L, et al. (2007) Identification of genes required for protection from doxorubicin by a genome-wide screen in Saccharomyces cerevisiae. Cancer Res 67(23):11411-8
       |ADK1 |AFG3 |ARP8 |ASC1 |ASF1 |BEM1 |BEM4 |CCS1 |COX6 |DBP3 |ERG3 |FLX1 |GAS1 |GND1 |MORE
Mutants/Phenotypes
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
DNA/RNA Sequence Features
Function/Process
Regulation of
Wade CH, et al. (2006) The budding yeast rRNA and ribosome biosynthesis (RRB) regulon contains over 200 genes. Yeast 23(4):293-306
       |AAH1 |ALB1 |ARX1 |ATC1 |BCP1 |BRX1 |BUD20 |CBF5 |CGR1 |CIC1 |CMS1 |DBP10 |DBP6 |DBP7 |MORE
Function/Process
Kyoda K, et al. (2004) DBRF-MEGN method: an algorithm for deducing minimum equivalent gene networks from large-scale gene expression profiles of gene deletion mutants. Bioinformatics 20(16):2662-75
               |ADE2 |AEP2 |AFG3 |AFT1 |ALD4 |ALD5 |ASE1 |CKA2 |CKB2 |CUP5 |CYC8 |DIG1 |DIG2 |ERG2 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |BUD30 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.