ERO1/YML130C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 13175 to 11484
CDS: 13175 - 11484

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERO1 YML130C ORF, Verified S000004599

Description
Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
FAD binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007266
Assigned on 2008-02-13 UniProtKB
electron carrier activity Frand AR and Kaiser CA (2000) Two pairs of conserved cysteines are required for the oxidative activity of Ero1p in protein disulfide bond formation in the endoplasmic reticulum. Mol Biol Cell 11(9):2833-43
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2003-02-24 SGD
oxidoreductase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0560
Assigned on 2007-05-23 UniProtKB
oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007266
Assigned on 2008-02-13 UniProtKB
thiol oxidase activity Gross E, et al. (2006) Generating disulfides enzymatically: reaction products and electron acceptors of the endoplasmic reticulum thiol oxidase Ero1p. Proc Natl Acad Sci U S A 103(2):299-304
       IDA : Inferred from Direct Assay
Assigned on 2006-10-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       RCA : Reviewed Computational Analysis
Assigned on 2009-03-03 SGD
electron transport chain GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0249
Assigned on 2008-10-02 UniProtKB
oxidation reduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007266
Assigned on 2009-04-20 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0560
Assigned on 2008-05-21 UniProtKB
protein folding Frand AR and Kaiser CA (1998) The ERO1 gene of yeast is required for oxidation of protein dithiols in the endoplasmic reticulum. Mol Cell 1(2):161-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-17 SGD
protein thiol-disulfide exchange Frand AR and Kaiser CA (2000) Two pairs of conserved cysteines are required for the oxidative activity of Ero1p in protein disulfide bond formation in the endoplasmic reticulum. Mol Biol Cell 11(9):2833-43
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-17 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007266
Assigned on 2008-02-13 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Pollard MG, et al. (1998) Ero1p: a novel and ubiquitous protein with an essential role in oxidative protein folding in the endoplasmic reticulum. Mol Cell 1(2):171-82
       IDA : Inferred from Direct Assay
Assigned on 2002-10-17 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007266
Assigned on 2009-06-17 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERO1/YML130C for ERO1
1) Frand AR and Kaiser CA (1998) The ERO1 gene of yeast is required for oxidation of protein dithiols in the endoplasmic reticulum. Mol Cell 1(2):161-70

2) Pollard MG, et al. (1998) Ero1p: a novel and ubiquitous protein with an essential role in oxidative protein folding in the endoplasmic reticulum. Mol Cell 1(2):171-82

3) Gross E, et al. (2006) Generating disulfides enzymatically: reaction products and electron acceptors of the endoplasmic reticulum thiol oxidase Ero1p. Proc Natl Acad Sci U S A 103(2):299-304

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERO1/YML130C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERO1/YML130C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MRLRTAI

C-term SYKLDIQ

Length(aa) 563

MW(Da) 65,032

pI 5.42

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.164

Codon Adaptation Index 0.217

Frequency of Optimal Codons 0.518

Hydropathicity of Protein -0.454

Aromaticity Score 0.123

10 20 30 40 50 | | | | | MRLRTAIATLCLTAFTSATSNNSYIATDQTQNAFNDTHFCKVDRNDHVSP SCNVTFNELNAINENIRDDLSALLKSDFFKYFRLDLYKQCSFWDANDGLC LNRACSVDVVEDWDTLPEYWQPEILGSFNNDTMKEADDSDDECKFLDQLC QTSKKPVDIEDTINYCDVNDFNGKNAVLIDLTANPERFTGYGGKQAGQIW STIYQDNCFTIGETGESLAKDAFYRLVSGFHASIGTHLSKEYLNTKTGKW EPNLDLFMARIGNFPDRVTNMYFNYAVVAKALWKIQPYLPEFSFCDLVNK EIKNKMDNVISQLDTKIFNEDLVFANDLSLTLKDEFRSRFKNVTKIMDCV QCDRCRLWGKIQTTGYATALKILFEINDADEFTKQHIVGKLTKYELIALL QTFGRLSESIESVNMFEKMYGKRLNGSENRLSSFFQNNFFNILKEAGKSI RYTIENINSTKEGKKKTNNSQSHVFDDLKMPKAEIVPRPSNGTVNKWKKA WNTEVNNVLEAFRFIYRSYLDLPRNIWELSLMKVYKFWNKFIGVADYVSE ETREPISYKLDIQ*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERO1/YML130C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to ERO1 Homolog Source (per PDB) Protein Alignment: ERO1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1rp4 ( Chain: A)
Structure of ero1p, source of disulfide bonds for oxidative protein folding in the cell
PDB_Info
PDB_Structure
Saccharomyces cerevisiae 2.8e-165 100 0 View alignment SCOP
MMDB
CATH
1rq1 ( Chain: A)
Structure of ero1p, source of disulfide bonds for oxidative protein folding in the cell
PDB_Info
PDB_Structure
Saccharomyces cerevisiae 2.8e-165 100 0 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ERO1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
ERO1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YML130C SGD Systematic Sequence

854909 NCBI: Gene ID

NP_013576.1 NCBI: RefSeq protein version ID

NP_013576.1 NCBI: RefSeq protein version ID

6323505 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YML130C	SGD Systematic Sequence
854909	NCBI: Gene ID
NP_013576.1	NCBI: RefSeq protein version ID
NP_013576.1	NCBI: RefSeq protein version ID
6323505	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
64 curated references; 0 references not yet curated
Function/Process
Costanzo M, et al. (2010) The genetic landscape of a cell. Science 327(5964):425-31
       |ECM30 |GAP1 |GET4 |HSP42 |MDY2 |PAR32 |PEX15 |SGT2 |SSE1 |SSE2 |UBP15
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Substrates/Ligands/Cofactors
Techniques and Reagents
Chu Y, et al. (2009) Structure-function analysis of human protein Ero1-Lalpha. Biochem Biophys Res Commun 389(4):645-50

Reviews
Ding J, et al. (2009) Tolerance and stress response to ethanol in the yeast Saccharomyces cerevisiae. Appl Microbiol Biotechnol 85(2):253-63
       |ADA2 |ASR1 |ATP1 |BEM2 |CHD1 |CTT1 |DDR2 |ERG6 |FEN1 |GCN5 |GIM4 |GIM5 |HFI1 |HMI1 |MORE
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Marino SM and Gladyshev VN (2009) A structure-based approach for detection of thiol oxidoreductases and their catalytic redox-active cysteine residues. PLoS Comput Biol 5(5):e1000383
         |AHP1 |BET3 |CAP2 |DOT5 |EPS1 |ERV1 |ERV2 |EUG1 |GLR1 |GPX1 |GPX2 |GRX1 |GRX2 |GRX3 |MORE
Mutants/Phenotypes
Regulation of
Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
       |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Reviews
Lopez-Mirabal HR and Winther JR (2008) Redox characteristics of the eukaryotic cytosol. Biochim Biophys Acta 1783(4):629-40
       |AHP1 |CTA1 |CTT1 |GLR1 |GRX1 |GRX2 |GSH1 |GSH2 |HYR1 |SOD1 |SOD2 |SRX1 |TRR1 |TRX1 |MORE
Mutants/Phenotypes
Protein Physical Properties
Protein Processing/Modification/Regulation
Strains/Constructs
Merksamer PI, et al. (2008) Real-time redox measurements during endoplasmic reticulum stress reveal interlinked protein folding functions. Cell 135(5):933-47
       |CYC1 |HAC1 |HRD1 |IRE1 |KAR2 |PDI1 |PRC1 |SEC61
Genetic Interactions
Mesecke N, et al. (2008) A Novel Group of Glutaredoxins in the cis-Golgi Critical for Oxidative Stress Resistance. Mol Biol Cell 19(6):2673-80
       |GRX6 |GRX7 |GRX8 |PDI1
RNA Levels and Processing
Translational Regulation
Payne T, et al. (2008) Transcript-specific translational regulation in the unfolded protein response of Saccharomyces cerevisiae. FEBS Lett 582(4):503-9
       |DER1 |HAC1
Non-Fungal Related Genes/Proteins
Tien AC, et al. (2008) Ero1L, a thiol oxidase, is required for Notch signaling through cysteine bridge formation of the Lin12-Notch repeats in Drosophila melanogaster. J Cell Biol 182(6):1113-25

Function/Process
Strains/Constructs
Wentz AE and Shusta EV (2008) Enhanced secretion of heterologous proteins from yeast by overexpression of ribosomal subunit RPP0. Biotechnol Prog 24(3):748-56
       |CCW12 |CWP2 |PMA1 |RPP0 |SED1
Regulation of
Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439
       |ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Mutants/Phenotypes
Bicknell AA, et al. (2007) A novel role in cytokinesis reveals a housekeeping function for the unfolded protein response. J Cell Biol 177(6):1017-27
     |BNI1 |CHS2 |CYK3 |HAC1 |HOF1 |MLC2
Genomic expression study
Large-scale protein detection
Castrillo JI, et al. (2007) Growth control of the eukaryote cell: a systems biology study in yeast. J Biol 6(2):4
       |ACO1 |ACO2 |ADH4 |ADO1 |ALD5 |ARG8 |CDC33 |CPA1 |CPA2 |DDI1 |DPP1 |ENO1 |ERG1 |ERG27 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Chakravarthi S, et al. (2007) Intracellular catalysis of disulfide bond formation by the human sulfhydryl oxidase, QSOX1. Biochem J 404(3):403-11
         |ERV2
Cross-species Expression
Fungal Related Genes/Proteins
Industrial Applications
Strains/Constructs
Gasser B, et al. (2007) Transcriptomics-based identification of novel factors enhancing heterologous protein secretion in yeasts. Appl Environ Microbiol 73(20):6499-507
       |BFR2 |BMH2 |COG6 |COY1 |CUP5 |HAC1 |IMH1 |KAR2 |KIN2 |PDI1 |SEC31 |SSA4 |SSE1 |SSO2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lopez-Mirabal HR, et al. (2007) Genetic interaction between the ero1-1 and leu2 mutations in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 71(12):2934-42
       |BAP2 |LEU2
Mutants/Phenotypes
Other Features
Strains/Constructs
Wentz AE and Shusta EV (2007) A novel high-throughput screen reveals yeast genes that increase secretion of heterologous proteins. Appl Environ Microbiol 73(4):1189-98
       |CCW12 |CWP2 |RPP0 |SED1
RNA Levels and Processing
Cullen PJ, et al. (2006) Genome-wide analysis of the response to protein glycosylation deficiency in yeast. FEMS Yeast Res 6(8):1264-73
     |ACS1 |ADR1 |ALD6 |AMS1 |CHS1 |CHS3 |CHS7 |CLB1 |CLB2 |CLN1 |CLN2 |CLN3 |CTT1 |DER1 |MORE
Non-Fungal Related Genes/Proteins
Dias-Gunasekara S, et al. (2006) Mutations in the FAD binding domain cause stress-induced misoxidation of the endoplasmic reticulum oxidoreductase Ero1beta. J Biol Chem 281(35):25018-25

Function/Process
Protein Physical Properties
Substrates/Ligands/Cofactors
Gross E, et al. (2006) Generating disulfides enzymatically: reaction products and electron acceptors of the endoplasmic reticulum thiol oxidase Ero1p. Proc Natl Acad Sci U S A 103(2):299-304

Reviews
Gruber CW, et al. (2006) Protein disulfide isomerase: the structure of oxidative folding. Trends Biochem Sci 31(8):455-64
       |EPS1 |ERV2 |EUG1 |MPD1 |MPD2 |PDI1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Genetic Interactions
Strains/Constructs
Subramanian S, et al. (2006) Pbn1p: an essential endoplasmic reticulum membrane protein required for protein processing in the endoplasmic reticulum of budding yeast. Proc Natl Acad Sci U S A 103(4):939-44
       |CNE1 |GAS1 |PBN1 |PHO8 |PRB1
DNA/RNA Sequence Features
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
Takemori Y, et al. (2006) Stress-induced transcription of the endoplasmic reticulum oxidoreductin gene ERO1 in the yeast Saccharomyces cerevisiae. Mol Genet Genomics 275(1):89-96
       |HAC1 |HSF1 |IRE1 |PDI1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
RNA Levels and Processing
Regulation of
Kleinschmidt M, et al. (2005) Transcriptional profiling of Saccharomyces cerevisiae cells under adhesion-inducing conditions. Mol Genet Genomics 273(5):382-93
           |AAD10 |APM3 |ARG1 |ARO10 |BAT2 |BIO3 |BRR2 |CPR6 |CUP1-1 |CUP1-2 |CWP2 |DDR48 |ECM22 |ERG12 |MORE
Cross-species Expression
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Lodi T, et al. (2005) Secretion of human serum albumin by Kluyveromyces lactis overexpressing KlPDI1 and KlERO1. Appl Environ Microbiol 71(8):4359-63
       |PDI1
Regulation of
Transcription
Matsumoto R, et al. (2005) The stress response against denatured proteins in the deletion of cytosolic chaperones SSA1/2 is different from heat-shock response in Saccharomyces cerevisiae. BMC Genomics 6():141
         |CTT1 |DER1 |HSP104 |HSP26 |HSP78 |KAR2 |MRP8 |MRPL10 |PDI1 |PRE1 |RPL25 |RPL37A |RPL8B |RPN12 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Reviews
Bardwell JC (2004) The dance of disulfide formation. Nat Struct Mol Biol 11(7):582-3

Cross-species Expression
Non-Fungal Related Genes/Proteins
Bertoli G, et al. (2004) Two conserved cysteine triads in human Ero1alpha cooperate for efficient disulfide bond formation in the endoplasmic reticulum. J Biol Chem 279(29):30047-52

Function/Process
Protein Sequence Features
Protein/Nucleic Acid Structure
Gross E, et al. (2004) Structure of Ero1p, source of disulfide bonds for oxidative protein folding in the cell. Cell 117(5):601-10
       |ERV2
RNA Levels and Processing
Regulation of
Hahn JS, et al. (2004) Genome-wide analysis of the biology of stress responses through heat shock transcription factor. Mol Cell Biol 24(12):5249-56
             |CPR6 |CTH1 |CUP1-1 |CWP1 |EDC2 |ENO2 |HOR7 |HSF1 |HSP30 |HSP82 |IRA2 |PDR3 |PGK1 |RPN4 |MORE
RNA Levels and Processing
Regulation of
Transcription
Haugen AC, et al. (2004) Integrating phenotypic and expression profiles to map arsenic-response networks. Genome Biol 5(12):R95
         |ARG1 |ARO1 |ARO2 |ARO7 |ARR1 |ARR2 |ARR3 |ATR1 |CAD1 |CDC26 |CIN2 |CIT2 |CPA1 |CPA2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Haynes CM, et al. (2004) Degradation of misfolded proteins prevents ER-derived oxidative stress and cell death. Mol Cell 15(5):767-76
         |ERV29 |HAC1 |HRD1 |IRE1 |PRC1
Reviews
Hiniker A and Bardwell JC (2004) Disulfide relays between and within proteins: the Ero1p structure. Trends Biochem Sci 29(10):516-9
             |ERV2
Cross-species Expression
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kettner K, et al. (2004) Schizosaccharomyces pombe ER oxidoreductin-like proteins SpEro1a p and SpEro1b p. Yeast 21(12):1035-44

Reviews
Tu BP and Weissman JS (2004) Oxidative protein folding in eukaryotes: mechanisms and consequences. J Cell Biol 164(3):341-6

Non-Fungal Related Genes/Proteins
Dixon DP, et al. (2003) Cloning and initial characterization of the Arabidopsis thaliana endoplasmic reticulum oxidoreductins. Antioxid Redox Signal 5(4):389-96

DNA/RNA Sequence Features
Regulation of
Transcription
Norgaard P, et al. (2003) Gene regulation in response to protein disulphide isomerase deficiency. Yeast 20(7):645-52
         |KAR2 |MPD1 |MPD2 |PDI1
Reviews
Bardwell JC (2002) Disulfide bond formation, a race between FAD and oxygen. Dev Cell 3(6):758-60

Reviews
Fassio A and Sitia R (2002) Formation, isomerisation and reduction of disulphide bonds during protein quality control in the endoplasmic reticulum. Histochem Cell Biol 117(2):151-7

Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Substrates/Ligands/Cofactors
Tsai B and Rapoport TA (2002) Unfolded cholera toxin is transferred to the ER membrane and released from protein disulfide isomerase upon oxidation by Ero1. J Cell Biol 159(2):207-16

Cellular Location
Function/Process
Substrates/Ligands/Cofactors
Tu BP and Weissman JS (2002) The FAD- and O(2)-dependent reaction cycle of Ero1-mediated oxidative protein folding in the endoplasmic reticulum. Mol Cell 10(5):983-94

RNA Levels and Processing
Regulation of
Alexandre H, et al. (2001) Global gene expression during short-term ethanol stress in Saccharomyces cerevisiae. FEBS Lett 498(1):98-103
             |AHP1 |ALD2 |ALD4 |APJ1 |ATG8 |CCC2 |CDC19 |CIT1 |CIT2 |CPR6 |CTT1 |DAK1 |EMI2 |EUG1 |MORE
Cellular Location
Function/Process
Gerber J, et al. (2001) Yeast ERV2p is the first microsomal FAD-linked sulfhydryl oxidase of the Erv1p/Alrp protein family. J Biol Chem 276(26):23486-91
       |ERV1 |ERV2
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Kadokura H and Beckwith J (2001) The expanding world of oxidative protein folding. Nat Cell Biol 3(11):E247-9
       |ERV1 |ERV2
Protein-protein Interactions
Nakanishi H, et al. (2001) Hut1 proteins identified in Saccharomyces cerevisiae and Schizosaccharomyces pombe are functional homologues involved in the protein-folding process at the endoplasmic reticulum. Yeast 18(6):543-54
     |HUT1 |MPD1 |MPD2 |PDI1
Cellular Location
Cross-species Expression
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Strains/Constructs
Pagani M, et al. (2001) The C-terminal domain of yeast Ero1p mediates membrane localization and is essential for function. FEBS Lett 508(1):117-20

Function/Process
Genetic Interactions
Strains/Constructs
Sevier CS, et al. (2001) A flavoprotein oxidase defines a new endoplasmic reticulum pathway for biosynthetic disulphide bond formation. Nat Cell Biol 3(10):874-82
       |ERV2 |PDI1
Cellular Location
Function/Process
Protein-protein Interactions
Substrates/Ligands/Cofactors
Burch WL and Herscovitz H (2000) Disulfide bonds are required for folding and secretion of apolipoprotein B regardless of its lipidation state. J Biol Chem 275(21):16267-74

Non-Fungal Related Genes/Proteins
Cabibbo A, et al. (2000) ERO1-L, a human protein that favors disulfide bond formation in the endoplasmic reticulum. J Biol Chem 275(7):4827-33

RNA Levels and Processing
Regulation of
Casagrande R, et al. (2000) Degradation of proteins from the ER of S. cerevisiae requires an intact unfolded protein response pathway. Mol Cell 5(4):729-35
             |HAC1 |IRE1 |KAR2 |LHS1 |PDI1
Function/Process
Protein Sequence Features
Frand AR and Kaiser CA (2000) Two pairs of conserved cysteines are required for the oxidative activity of Ero1p in protein disulfide bond formation in the endoplasmic reticulum. Mol Biol Cell 11(9):2833-43
       |PDI1
Cellular Location
Function/Process
Frand AR, et al. (2000) Pathways for protein disulphide bond formation. Trends Cell Biol 10(5):203-10

Cross-species Expression
Non-Fungal Related Genes/Proteins
Pagani M, et al. (2000) Endoplasmic reticulum oxidoreductin 1-lbeta (ERO1-Lbeta), a human gene induced in the course of the unfolded protein response. J Biol Chem 275(31):23685-92

Regulation of
Travers KJ, et al. (2000) Functional and genomic analyses reveal an essential coordination between the unfolded protein response and ER-associated degradation. Cell 101(3):249-58
           |EUG1 |FPR2 |INO1 |IRE1 |KAR2 |LHS1 |OPI1 |PDI1
Function/Process
Genetic Interactions
Substrates/Ligands/Cofactors
Tu BP, et al. (2000) Biochemical basis of oxidative protein folding in the endoplasmic reticulum. Science 290(5496):1571-4
       |FAD1 |PDI1
Function/Process
Cuozzo JW and Kaiser CA (1999) Competition between glutathione and protein thiols for disulphide-bond formation. Nat Cell Biol 1(3):130-5

Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Frand AR and Kaiser CA (1999) Ero1p oxidizes protein disulfide isomerase in a pathway for disulfide bond formation in the endoplasmic reticulum. Mol Cell 4(4):469-77
       |EUG1 |MPD2 |PDI1
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Regulation of
Strains/Constructs
Frand AR and Kaiser CA (1998) The ERO1 gene of yeast is required for oxidation of protein dithiols in the endoplasmic reticulum. Mol Cell 1(2):161-70
       |PDI1
Reviews
Freedman RB, et al. (1998) Protein folding: a missing redox link in the endoplasmic reticulum. Curr Biol 8(13):R468-70

Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Pollard MG, et al. (1998) Ero1p: a novel and ubiquitous protein with an essential role in oxidative protein folding in the endoplasmic reticulum. Mol Cell 1(2):171-82

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.