---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

COX14/YML129C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 14754 to 14542 CDS: 14754 - 14542 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
COX14	YML129C		ORF, Verified	S000004598
Description
Mitochondrial membrane protein, involved in translational regulation of Cox1p and assembly of cytochrome c oxidase (complex IV); associates with complex IV assembly intermediates and complex III/complex IV supercomplexes

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-01-19 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By negative regulation of mitochondrial translation Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82        IPI : Inferred from Physical Interaction with SGD:MSS51 Assigned on 2009-12-04 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By extrinsic to membrane Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82        IDA : Inferred from Direct Assay Assigned on 2005-03-01 SGD integral to membrane Glerum DM, et al. (1995) Cloning and characterization of COX14, whose product is required for assembly of yeast cytochrome oxidase. J Biol Chem 270(26):15585-90        IDA : Inferred from Direct Assay Assigned on 2002-06-07 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial envelope Glerum DM, et al. (1995) Cloning and characterization of COX14, whose product is required for assembly of yeast cytochrome oxidase. J Biol Chem 270(26):15585-90        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD mitochondrial inner membrane Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82        IDA : Inferred from Direct Assay Assigned on 2005-03-01 SGD mitochondrial matrix Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82        IDA : Inferred from Direct Assay Assigned on 2005-03-01 SGD mitochondrion Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for COX14/YML129C for COX14 COX14 encodes a protein of unknown function that is an integral component of mitochondrial membranes (1). The phenotype of the cox14 null mutant suggests that Cox14p is required for assembly of cytochrome c oxidase: the null mutant displays a respiratory growth deficiency, lacks cytochrome c oxidase activity, and displays reduced accumulation of cytochrome c oxidase subunits, a phenotype commonly observed for mutations that block assembly of the enzyme (1). Cox14p is not a subunit of cytochrome c oxidase, but sediments as part of a 150,000 dalton complex whose other constituents are unidentified (1). An apparently orthologous gene has been identified in Kluyveromyces lactis (2). Last Updated: 2002-06-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forCOX14/YML129C for COX14 1) Glerum DM, et al. (1995) Cloning and characterization of COX14, whose product is required for assembly of yeast cytochrome oxidase. J Biol Chem 270(26):15585-90        2) Fiori A, et al. (2000) Isolation and molecular characterization of KlCOX14, a gene of Kluyveromyces lactis encoding a protein necessary for the assembly of the cytochrome oxidase complex. Yeast 16(4):307-14        3) Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82        4) Mick DU, et al. (2007) Shy1 couples Cox1 translational regulation to cytochrome c oxidase assembly. EMBO J 26(20):4347-58

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for COX14/YML129C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for COX14/YML129C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSKYAWY C-term PTAPPTE Length(aa) 70 MW(Da) 7,959 pI 7.53 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.253   Codon Adaptation Index 0.189   Frequency of Optimal Codons 0.545   Hydropathicity of Protein -0.590   Aromaticity Score 0.100	10 20 30 40 50 | | | | | MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQ QKALEEDNQQLQSPTAPPTE*

Protein Structures from PDB: proteins of known structure with sequence similarity to COX14/YML129C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
COX14	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YML129C	SGD Systematic Sequence
854910	NCBI: Gene ID
NP_013577.1	NCBI: RefSeq protein version ID
NP_013577.1	NCBI: RefSeq protein version ID
6323506	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]

Protein Details Topic Research Highlight Reference Contributor Other Protein Details Description: Apart form the overall increase in mitochondrial protein mass after the diauxic shift this protein remains unchanged after the diauxic shift. otherTopic: Regulated by the diauxic shift (glycerol) Ohlmeier S, et al. (2004) The yeast mitochondrial proteome, a study of fermentative and respiratory growth. J Biol Chem 279(6):3956-79        Steffen Ohlmeier 2004-04-08

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
34 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Bestwick M, et al. (2010) The role of coa2 in hemylation of yeast cox1 revealed by its genetic interaction with cox10. Mol Cell Biol 30(1):172-85	|COA1 |COA2 |COX1 |COX10 |COX11 |COX15 |COX4 |MSS51 |OMA1 |SCO1 |SHY1 |YME1
Mutants/Phenotypes Protein-protein Interactions	Fontanesi F, et al. (2010) Mss51 and ssc1 facilitate translational regulation of cytochrome C oxidase biogenesis. Mol Cell Biol 30(1):245-59	|COA1 |COX1 |COX11 |MDJ1 |MRP51 |MRPL36 |MSS51 |SHY1 |SSC1
Protein-protein Interactions	Khalimonchuk O, et al. (2010) Formation of the redox cofactor centers during Cox1 maturation in yeast cytochrome oxidase. Mol Cell Biol 30(4):1004-17	|COA1 |COX1 |COX10 |COX11 |MSS51 |SCO1 |SHY1
Reviews	Lipinski KA, et al. (2010) Maintenance and expression of the S. cerevisiae mitochondrial genome - from genetics to evolution and systems biology. Biochim Biophys Acta	|AEP1 |AEP2 |AEP3 |APN1 |ATP25 |CBP1 |CBP2 |CBP6 |CBS1 |CBS2 |CBT1 |CCE1 |DNA2 |DSS1 |MORE
Other Features Strains/Constructs	Merz S and Westermann B (2009) Genome-wide deletion mutant analysis reveals genes required for respiratory growth, mitochondrial genome maintenance and mitochondrial protein synthesis in Saccharomyces cerevisiae. Genome Biol 10(9):R95	|AIM22 |ATP18 |ATP4 |CCM1 |COQ10 |COQ3 |COQ5 |COX10 |COX16 |COX19 |COX20 |CST6 |CTR1 |CYC3 |MORE
Function/Process Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs	Perez-Martinez X, et al. (2009) Dual Functions of Mss51 Couple Synthesis of Cox1 to Assembly of Cytochrome c Oxidase in Saccharomyces cerevisiae Mitochondria. Mol Biol Cell 20(20):4371-80	|COX1 |COX2 |MSS2 |MSS51 |PET309
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Soto IC, et al. (2009) Synthesis of cytochrome c oxidase subunit 1 is translationally downregulated in the absence of functional F(1)F(0)-ATP synthase. Biochim Biophys Acta 1793(11):1776-86	|ATP10 |ATP12 |COX1
Techniques and Reagents	Stuart RA (2009) Chapter 11 Supercomplex organization of the yeast respiratory chain complexes and the ADP/ATP carrier proteins. Methods Enzymol 456:191-208	|COR1 |COX2 |COX5A |PET9 |QCR2 |SHY1 |TIM17 |TIM23
Mutants/Phenotypes	Yoshikawa K, et al. (2009) Comprehensive phenotypic analysis for identification of genes affecting growth under ethanol stress in Saccharomyces cerevisiae. FEMS Yeast Res 9(1):32-44	|ALD6 |ARO1 |ARO2 |ARO7 |COQ10 |COQ5 |COQ9 |COX11 |COX12 |COX16 |COX18 |COX23 |COX7 |COX9 |MORE
Reviews	Greiner P, et al. (2008) Biogenesis of cytochrome c oxidase - in vitro approaches to study cofactor insertion into a bacterial subunit I. Biochim Biophys Acta 1777(7-8):904-911	|ARH1 |CMC1 |COA1 |COA2 |COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX19 |MORE
Reviews	Stuart RA (2008) Supercomplex organization of the oxidative phosphorylation enzymes in yeast mitochondria. J Bioenerg Biomembr 40(5):411-7	|ATP1 |ATP14 |ATP15 |ATP16 |ATP17 |ATP18 |ATP19 |ATP2 |ATP20 |ATP3 |ATP4 |ATP5 |ATP6 |ATP7 |MORE
Regulation of Transcription	De Nicola R, et al. (2007) Physiological and Transcriptional Responses of Saccharomyces cerevisiae to Zinc Limitation in Chemostat Cultures. Appl Environ Microbiol 73(23):7680-92	|ADE17 |ADH4 |ATP14 |ATP15 |ATP18 |ATP20 |ATP3 |ATP4 |COM2 |COX23 |DPP1 |FET4 |GAC1 |GDB1 |MORE
Reviews	Eisenberg T, et al. (2007) The mitochondrial pathway in yeast apoptosis. Apoptosis 12(5):1011-23	|AIF1 |CDC13 |CDC48 |COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX19 |COX2 |MORE
Mutants/Phenotypes Strains/Constructs	Khalimonchuk O, et al. (2007) Evidence for a pro-oxidant intermediate in the assembly of cytochrome oxidase. J Biol Chem 282(24):17442-9	|AFG1 |CCP1 |COX1 |COX10 |COX11 |COX2 |COX20 |COX3 |CTT1 |PET111 |PET309 |SCO1 |STR2
Function/Process Protein-protein Interactions Strains/Constructs	Mick DU, et al. (2007) Shy1 couples Cox1 translational regulation to cytochrome c oxidase assembly. EMBO J 26(20):4347-58	|COA1 |COR1 |COX1 |COX2 |COX3 |COX4 |COX5A |CYT1 |MSS51 |PET9 |QCR2 |QCR6 |RIP1 |SHY1
Cellular Location Protein-protein Interactions Strains/Constructs	Pierrel F, et al. (2007) Coa1 links the Mss51 post-translational function to Cox1 cofactor insertion in cytochrome c oxidase assembly. EMBO J 26(20):4335-46	|COA1 |COX1 |COX10 |MDJ1 |MSS1 |MSS51 |SHY1
Mutants/Phenotypes Strains/Constructs	Zambrano A, et al. (2007) Aberrant translation of cytochrome c oxidase subunit 1 mRNA species in the absence of Mss51p in the yeast Saccharomyces cerevisiae. Mol Biol Cell 18(2):523-35	|COX1 |MSS51 |PET309
Genetic Interactions	Barros MH, et al. (2006) COX24 codes for a mitochondrial protein required for processing of the COX1 transcript. J Biol Chem 281(6):3743-51	|AI2 |AI3 |COX1 |QRI5
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Other Features	Nishida H (2006) Detection and Characterization of Fungal-Specific Proteins in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 70(11):2646-52	|AGA1 |AIM26 |BUD25 |CWP2 |DDR2 |DSE2 |FYV5 |HOR7 |MFA1 |MFA2 |TOS6 |YAL064W-B |YAR068W |YBL039W-B |MORE
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Mutants/Phenotypes Strains/Constructs	Viau C, et al. (2006) Sensitivity to Sn(2+) of the Yeast Saccharomyces cerevisiae Depends on General Energy Metabolism, Metal Transport, Anti-Oxidative Defences, and DNA Repair. Biometals 19(6):705-14	|APN1 |ATR1 |COX11 |COX15 |COX16 |COX17 |COX18 |COX20 |CTT1 |ERG3 |NTG1 |NTG2 |PET100 |PET117 |MORE
Reviews	Zee JM and Glerum DM (2006) Defects in cytochrome oxidase assembly in humans: lessons from yeast. Biochem Cell Biol 84(6):859-69	|COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX19 |COX2 |COX20 |COX23 |COX3 |MORE
Reviews	Herrmann JM and Funes S (2005) Biogenesis of cytochrome oxidase-sophisticated assembly lines in the mitochondrial inner membrane. Gene 354:43-52	|COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX19 |COX2 |COX20 |COX3 |COX4 |MORE
Function/Process Genetic Interactions Protein-protein Interactions Strains/Constructs	Barrientos A, et al. (2004) Mss51p and Cox14p jointly regulate mitochondrial Cox1p expression in Saccharomyces cerevisiae. EMBO J 23(17):3472-82	|COX1 |MSS51 |SHY1
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Reviews	Barrientos A, et al. (2002) Cytochrome oxidase in health and disease. Gene 286(1):53-63	|COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX2 |COX20 |COX23 |COX3 |COX4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Barros MH and Tzagoloff A (2002) Regulation of the heme A biosynthetic pathway in Saccharomyces cerevisiae. FEBS Lett 516(1-3):119-23	|COX10 |COX11 |COX15 |COX18 |COX20 |CYC3 |IMP1 |IMP2 |PET111 |PET117 |SCO1 |SHY1
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Fungal Related Genes/Proteins	Fiori A, et al. (2002) Suppression of a nuclear frameshift mutation by a mitochondrial tRNA in the yeast Kluyveromyces lactis. Mol Microbiol 46(1):169-77
Fungal Related Genes/Proteins	Fiori A, et al. (2000) Isolation and molecular characterization of KlCOX14, a gene of Kluyveromyces lactis encoding a protein necessary for the assembly of the cytochrome oxidase complex. Yeast 16(4):307-14
Alias Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Glerum DM, et al. (1995) Cloning and characterization of COX14, whose product is required for assembly of yeast cytochrome oxidase. J Biol Chem 270(26):15585-90	|COX1 |COX12 |COX13 |COX2 |COX3 |COX4 |COX5A |COX6 |COX7 |COX8 |COX9
Protein Physical Properties Protein/Nucleic Acid Structure	Stevens TH, et al. (1982) The nature of CuA in cytochrome c oxidase. J Biol Chem 257(20):12106-13	|COX1 |COX10 |COX11 |COX12 |COX13 |COX15 |COX16 |COX17 |COX18 |COX19 |COX2 |COX20 |COX3 |COX4 |MORE

Return to SGD

Send a Message to the SGD Curators