---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP188/YML103C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXIII: 67549 to 62582 CDS: 67549 - 62582 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP188	YML103C		ORF, Verified	S000004571
Description
Subunit of the nuclear pore complex (NPC), involved in the structural organization of the complex and of the nuclear envelope, also involved in nuclear envelope permeability, interacts with Pom152p and Nic96p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP188/YML103C for NUP188 NUP188 encodes a nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). Nup188p is one of the most abundant yeast nucleoporins (1). Nup188p interacts physically with other abundant yeast nucleoporins, Nic96p, Pom152p, Nup157p, and Nup170p (15, 2). These abundant nucleoporins may form the structural core of the NPC (2). NUP188 is not essential, but both null and dominant alleles cause temperature sensitivity and defects in nuclear envelope morphology (15, 16). The nup188 null also causes a defect in protein import into the nucleus, which can be suppressed by overexpressing cytosolic HSP70-related chaperones (17). nup188 mutations are also synthetically lethal with mutations in several other nucleoporin genes (1, 15, 2, 18). Last Updated: 1999-08-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP188/YML103C for NUP188 1) Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Nehrbass U, et al. (1996) The yeast nucleoporin Nup188p interacts genetically and physically with the core structures of the nuclear pore complex. J Cell Biol 133(6):1153-62      16) Zabel U, et al. (1996) Nic96p is required for nuclear pore formation and functionally interacts with a novel nucleoporin, Nup188p. J Cell Biol 133(6):1141-52      17) Shulga N, et al. (1999) A nuclear export signal prevents Saccharomyces cerevisiae Hsp70 Ssb1p from stimulating nuclear localization signal-directed nuclear transport. J Biol Chem 274(23):16501-7        18) Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8        19) Shulga N, et al. (2000) Yeast nucleoporins involved in passive nuclear envelope permeability. J Cell Biol 149(5):1027-38

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP188/YML103C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP188/YML103C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MATPSFG C-term DSLFKDV Length(aa) 1,655 MW(Da) 188,575 pI 5.36 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.067   Codon Adaptation Index 0.153   Frequency of Optimal Codons 0.458   Hydropathicity of Protein 0.021   Aromaticity Score 0.097

10 20 30 40 50 | | | | | MATPSFGNSSPQLTFTHVANFMNDAAADVSAVDAKQLAQIRQFLKANKTN LIESLNTIRQNVTSSGDHNKLRSTIANLLQINVDNDPFFAQSEDLSHAVE FFMSERSSRLHIVYSLLVNPDIDLETYSFIDNDRFNVVGKLISIISSVIQ NYDIITASSLAHDYNNDQDMFTIVSLVQLKKFSDLKFILQILQILNLMIL NTKVPVDIVNQWFLQYQNQFVEFCRNINSTDKSIDTSSLQLYKFQNFQDL SYLSETLISRISSLFTITTILILGLNTSIAQFDIQSPLYMDTETFDTVNS ALENDVATNIVNEDPIFHPMIHYSWSFILYYRRALQSSESFDDSDITKFA LFAESHDVLQKLNTLSEILSFDPVYTTVITVFLEFSLNFIPITASTSRVF AKIISKAPEQFIENFLTNDTFEKKLSIIKAKLPLLNESLIPLINLALIDT EFANFELKDICSFAVTKSSLNDLDYDLIADTITNSSSSSDIIVPDLIELK SDLLVAPPLENENSNCLLSIPKSTKGKILTIKQQQQQQQQQNGQQPPTTS NLIIFLYKFNGWSLVGRILQNLLHSYMEKGTQLDDLQHELMISIIKLVTN VVDPKTSIEKSSEILSYLSNSLDTSASTINGASIIQVIFEIFEISLQRKD YTSIVQCCEFMTMLTPNYLHLVSSYLNKSDLLDKYGKTGLSNMILGSVEL STGDYTFTIQLLKLTKVFIRESLSLKNIHISKRSKIDIINKLILHAIHIF ESYYNWKYNNFLQKFEIAFHLTLIFYDVLHDVFTINPHQKDQLIISSSAN KLLQLFLTPMDSIDLAPNTLTNILISPLNTTTKILGDKILGNLYSKVMNN SFKLCTLLIAIRGSNRDLKPSNLEKLLFINSSKLVDVYTLPSYVHFKVQI IELLSYLVEAPWNDDYPFLLSFLGEAKSMAFLKEVLSDLSSPVQDWNLLR SLYIFFTTLLESKQDGLSILFLTGQFASNKKINDESSIDKKSSILTVLQK NSLLLDSTPEEVSCKLLETITYVLNTWTNSKIFIKDPKFVNSLLAKLKDS KKLFQKKENLTRDETVSLIKKYKLISRIVEIFALCIYNSTDSNSEILNFL NQEDLFELVHHFFQIDGFNKTFHDELNLKFKEKWPSLELQSFQKIPLSRI NENENFGYDIPLLDIVLKADRSWNEPSKSQTNFKEEITDASLNLQYVNYE ISTAKAWGALITTFVKRSTVPLNDGFVDLVEHFLKLNIDFGSDKQMFTQI YLERIELSFYILYSFKLSGKLLKEEKIIELMNKIFTIFKSGEIDFIKNIG KSLKNNFYRPLLRSVLVLLELVSSGDRFIELISDQLLEFFELVFSKGVYL ILSEILCQINKCSTRGLSTDHTTQIVNLEDNTQDLLLLLSLFKKITNVNP SKNFNVILASSLNEVGTLKVILNLYSSAHLIRINDEPILGQITLTFISEL CSIEPIAAKLINSGLYSVLLESPLSVAIQQGDIKPEFSPRLHNIWSNGLL SIVLLLLSQFGIKVLPETCLFVSYFGKQIKSTIYNWGDNKLAVSSSLIKE TNQLVLLQKMLNLLNYQELFIQPKNSDDQQEAVELVIGLDSEHDKKRLSA ALSKFLTHPKYLNSRIIPTTLEEQQQLEDESSRLEFVKGISRDIKALQDS LFKDV*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP188/YML103C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP188	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YML103C	SGD Systematic Sequence
854868	NCBI: Gene ID
NP_013604.1	NCBI: RefSeq protein version ID
NP_013604.1	NCBI: RefSeq protein version ID
6323533	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
43 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP116 |NUP120 |NUP133 |NUP145 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Cellular Location Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP1 |NUP157 |NUP159 |NUP170 |NUP2 |NUP82 |POM152 |POM34
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Cellular Location Strains/Constructs	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP157 |NUP170 |NUP2 |NUP53 |NUP82 |POM152 |POM34
Reviews	Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9	|ASM4 |NDC1 |NIC96 |NUP157 |NUP170 |NUP53 |NUP82 |NUP84 |POM152 |POM34 |RTN1 |YOP1
Large-scale phenotype analysis	Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508	|AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Genetic Interactions	Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66	|APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Amaro IA, et al. (2008) The Saccharomyces cerevisiae Homolog of p24 Is Essential for Maintaining the Association of p150Glued With the Dynactin Complex. Genetics 178(2):703-9	|AIM4 |APQ12 |ARP1 |ARP10 |ASE1 |BIK1 |BIM1 |BNI1 |BUB1 |BUB3 |CHL4 |CIN1 |CIN2 |CTF18 |MORE
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP159 |NUP2 |NUP42 |MORE
Regulatory Role Strains/Constructs	van Heusden GP and Steensma HY (2008) The Saccharomyces cerevisiae Wss1 protein is only present in mother cells. FEMS Microbiol Lett 282(1):100-4	|ARP1 |GIM4 |SGS1 |WSS1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP192 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP170 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Genetic Interactions	Milgrom E, et al. (2005) TFIID and Spt-Ada-Gcn5-acetyltransferase functions probed by genome-wide synthetic genetic array analysis using a Saccharomyces cerevisiae taf9-ts allele. Genetics 171(3):959-73	|ADA2 |AIM4 |ARP6 |ASF1 |BCK1 |BDF1 |BEM1 |BEM4 |BUB1 |CDC7 |CDC73 |CLA4 |CTK1 |CTK2 |MORE
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Mutants/Phenotypes Strains/Constructs	Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19	|ASM4 |MAD1 |MAD2 |NUP100 |NUP157 |NUP170 |NUP53 |POM152
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Non-Fungal Related Genes/Proteins	Miller BR, et al. (2000) Identification of a new vertebrate nucleoporin, Nup188, with the use of a novel organelle trap assay. Mol Biol Cell 11(10):3381-96
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Shulga N, et al. (2000) Yeast nucleoporins involved in passive nuclear envelope permeability. J Cell Biol 149(5):1027-38	|KAP104 |KAP95 |NAB2 |NUP170 |PHO4 |PSE1 |SRP1 |SSA1
Function/Process Mutants/Phenotypes Strains/Constructs	Shulga N, et al. (1999) A nuclear export signal prevents Saccharomyces cerevisiae Hsp70 Ssb1p from stimulating nuclear localization signal-directed nuclear transport. J Biol Chem 274(23):16501-7	|CRM1 |SSA1 |SSB1
Genetic Interactions Mutants/Phenotypes	Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8	|ASM4 |NIC96 |NUP170 |POM152
Fungal Related Genes/Proteins	Whalen WA, et al. (1999) Regulation of mRNA export by nutritional status in fission yeast. Genetics 152(3):827-38	|TPK1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP2 |NUP42 |NUP49 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Nehrbass U, et al. (1996) The yeast nucleoporin Nup188p interacts genetically and physically with the core structures of the nuclear pore complex. J Cell Biol 133(6):1153-62	|NIC96 |POM152
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Zabel U, et al. (1996) Nic96p is required for nuclear pore formation and functionally interacts with a novel nucleoporin, Nup188p. J Cell Biol 133(6):1141-52	|NIC96
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48	|NIC96 |NUP157 |NUP170 |POM152
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP116 |NUP133 |NUP159 |NUP2 |NUP57 |NUP82 |NUP84 |NUP85 |POM152

Return to SGD

Send a Message to the SGD Curators