ERV41/YML067C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 140214 to 139063
intron: 140183 - 140091
CDS: 140214 - 140184, 140090 - 139063

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERV41 YML067C ORF, Verified S000004532

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-04-24. Gene name expires on 2001-04-24.
Description
Protein localized to COPII-coated vesicles, forms a complex with Erv46p; involved in the membrane fusion stage of transport; has homology to human ERGIC2 (PTX1) protein

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-07-16 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IPI : Inferred from Physical Interaction
Assigned on 2002-07-16 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi transport vesicle Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to Golgi membrane Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
integral to endoplasmic reticulum membrane Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERV41/YML067C for ERV41
1) Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18

2) Kwok SC, et al. (2006) PTX1(ERGIC2)-VP22 fusion protein upregulates interferon-beta in prostate cancer cell line PC-3. DNA Cell Biol 25(9):523-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERV41/YML067C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERV41/YML067C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAGLKTF

C-term TKGILDR

Length(aa) 352

MW(Da) 40,705

pI 4.59

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.105

Codon Adaptation Index 0.174

Frequency of Optimal Codons 0.481

Hydropathicity of Protein -0.171

Aromaticity Score 0.142

10 20 30 40 50 | | | | | MAGLKTFDAFPKTEEQYKKKSTKGGLTSLLTYLFLLFIAWTEFGEYFGGY IDQQYVVDSQVRDTVQINMDIYVNTKCDWLQINVRDQTMDRKLVLEELQL EEMPFFIPYDTKVNDINEIITPELDEILGEAIPAEFREKLDTRSFFDESD PNKAHLPEFNGCHVFGSIPVNRVSGELQITAKSLGYVASRKAPLEELKFN HVINEFSFGDFYPYIDNPLDNTAQFNQDEPLTTYVYYTSVVPTLFKKLGA EVDTNQYSVNDYRYLYKDVAAKGDKMPGIFFKYNFEPLSIVVSDVRLSFI QFLVRLVAICSFLVYCASWIFTLLDMALITIMGPKWSLRYQPDDKTKGIL DR*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERV41/YML067C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ERV41 2001-10-09 SGD (2007) Information without a citation in SGD

Standard Name	Date Standardized	Reference
ERV41	2001-10-09	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YML067C SGD Systematic Sequence

854935 NCBI: Gene ID

NP_013644.1 NCBI: RefSeq protein version ID

NP_013644.1 NCBI: RefSeq protein version ID

6323573 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YML067C	SGD Systematic Sequence
854935	NCBI: Gene ID
NP_013644.1	NCBI: RefSeq protein version ID
NP_013644.1	NCBI: RefSeq protein version ID
6323573	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
18 curated references; 0 references not yet curated
Genetic Interactions
Kim JH, et al. (2009) The unfolded protein response is necessary but not sufficient to compensate for defects in disulfide isomerization. J Biol Chem 284(16):10400-8
         |ALG8 |APM3 |APS3 |ARL1 |AVL9 |CCZ1 |CDC50 |COG8 |EPS1 |ERV46 |EUG1 |FLD1 |GCS1 |GEF1 |MORE
Mutants/Phenotypes
Strains/Constructs
Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
       |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Reviews
Baines AC and Zhang B (2007) Receptor-mediated protein transport in the early secretory pathway. Trends Biochem Sci 32(8):381-8
       |EMP24 |EMP46 |EMP47 |ERV14 |ERV25 |ERV29 |ERV46 |SAR1 |SEC13 |SEC23 |SEC24 |SEC31 |SFB2 |SFB3 |MORE
Mutants/Phenotypes
Techniques and Reagents
Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
       |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Non-Fungal Related Genes/Proteins
Kwok SC, et al. (2006) PTX1(ERGIC2)-VP22 fusion protein upregulates interferon-beta in prostate cancer cell line PC-3. DNA Cell Biol 25(9):523-9

RNA Levels and Processing
Regulation of
Tanaka F, et al. (2006) Functional genomic analysis of commercial baker's yeast during initial stages of model dough-fermentation. Food Microbiol 23(8):717-28
         |ACE2 |ACO1 |ACS1 |ACS2 |ACT1 |ADH1 |ADH2 |ADH5 |ADK1 |AIM38 |ALD2 |ALG8 |ARG1 |ARG3 |MORE
Mutants/Phenotypes
Protein-protein Interactions
Welsh LM, et al. (2006) Genetic and molecular interactions of the Erv41p-Erv46p complex involved in transport between the endoplasmic reticulum and Golgi complex. J Cell Sci 119(Pt 22):4730-40
         |ERV46 |ROT2 |VMA21 |VMA22 |VPH2 |VPS1
Cellular Location
Protein-protein Interactions
Ballew N, et al. (2005) A Rab requirement is not bypassed in SLY1-20 suppression. Mol Biol Cell 16(4):1839-49
       |BET3 |COG2 |COG3 |SEC22 |SED5 |SLY1 |USO1 |YPT1 |YPT31 |YPT32 |YPT6
Non-Fungal Related Genes/Proteins
Hellauer K, et al. (2005) Large-scale analysis of genes that alter sensitivity to the anticancer drug tirapazamine in Saccharomyces cerevisiae. Mol Pharmacol 68(5):1365-75
       |AGP3 |BNR1 |CAF40 |CMR1 |DNL4 |DPL1 |EKI1 |FYV10 |KNS1 |NCP1 |PAF1 |PUS4 |RAD18 |RAS1 |MORE
Cellular Location
Inadome H, et al. (2005) Immunoisolaton of the yeast Golgi subcompartments and characterization of a novel membrane protein, Svp26, discovered in the Sed5-containing compartments. Mol Cell Biol 25(17):7696-710
       |AKR1 |ANP1 |ARF1 |ATG27 |DPM1 |EHT1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV46 |GCS1 |MORE
Protein-protein Interactions
Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8
       |ARV1 |EMP24 |EMP46 |EMP47 |ERD1 |ERD2 |ERG11 |ERP5 |ERV29 |MST27 |PHO84 |PHO88 |SEC61 |SHR3 |MORE
Reviews
Bonifacino JS and Glick BS (2004) The mechanisms of vesicle budding and fusion. Cell 116(2):153-66
       |BET1 |EMP24 |EMP46 |EMP47 |ERV25 |GAP1 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC23 |SEC24 |MORE
Non-Fungal Related Genes/Proteins
Breuza L, et al. (2004) Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46. J Biol Chem 279(45):47242-53
       |ERV46
Cellular Location
Function/Process
Protein Sequence Features
Regulation of
Otte S and Barlowe C (2002) The Erv41p-Erv46p complex: multiple export signals are required in trans for COPII-dependent transport from the ER. EMBO J 21(22):6095-104
         |ERV46
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Techniques and Reagents
Cho JH, et al. (2001) A novel membrane protein complex on the endoplasmic reticulum and early Golgi compartments in the yeast Saccharomyces cerevisiae. Biosci Biotechnol Biochem 65(10):2226-32
     |ERV46
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
RNA Levels and Processing
Techniques and Reagents
Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       |BET1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV29 |ERV46 |RER1 |YIF1 |YIP3 |YPT1
Cellular Location
Cho JH, et al. (2000) Proteins in the early golgi compartment of Saccharomyces cerevisiae immunoisolated by Sed5p. FEBS Lett 469(2-3):151-4
       |ANP1 |EMP24 |ERP1 |ERV25 |KEX2 |KRE2 |MNN9 |SEC66 |SED5 |VAN1 |YPT52
DNA/RNA Sequence Features
Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6
       |AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.