SUR7/YML052W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXIII: 170402 to 171310
CDS: 170402 - 171310

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SUR7 YML052W ORF, Verified S000004516

Description
Plasma membrane protein that localizes to furrow-like invaginations (MCC patches); component of eisosomes; associated with endocytosis, along with Pil1p and Lsp1p; sporulation and plasma membrane sphingolipid content are altered in mutants

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-06-12 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ascospore formation Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-06-12 SGD
endocytosis Walther TC, et al. (2006) Eisosomes mark static sites of endocytosis. Nature 439(7079):998-1003
         IGI : Inferred from Genetic Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2006-03-03 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0254
Assigned on 2009-05-05 UniProtKB
sporulation resulting in formation of a cellular spore GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0749
Assigned on 2009-05-05 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
NOT: actin cortical patch Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       IDA : Inferred from Direct Assay
Assigned on 2002-06-12 SGD
ascospore wall Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       IDA : Inferred from Direct Assay
Assigned on 2006-03-06 SGD
cell cortex Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       IDA : Inferred from Direct Assay
Assigned on 2002-06-12 SGD
Walther TC, et al. (2006) Eisosomes mark static sites of endocytosis. Nature 439(7079):998-1003
         IDA : Inferred from Direct Assay
Assigned on 2006-07-21 SGD
eisosome Walther TC, et al. (2006) Eisosomes mark static sites of endocytosis. Nature 439(7079):998-1003
         IDA : Inferred from Direct Assay
Assigned on 2008-09-22 SGD
integral to membrane Sivadon P, et al. (1997) Cloning of the multicopy suppressor gene SUR7: evidence for a functional relationship between the yeast actin-binding protein Rvs167 and a putative membranous protein. Yeast 13(8):747-61
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-06-12 SGD
Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-06-12 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-05-05 UniProtKB
membrane fraction Aronova S, et al. (2007) Probing the Membrane Environment of the TOR Kinases Reveals Functional Interactions between TORC1, Actin, and Membrane Trafficking in Saccharomyces cerevisiae. Mol Biol Cell 18(8):2779-94
     IDA : Inferred from Direct Assay
Assigned on 2007-06-29 SGD
membrane raft Malinska K, et al. (2004) Distribution of Can1p into stable domains reflects lateral protein segregation within the plasma membrane of living S. cerevisiae cells. J Cell Sci 117(Pt 25):6031-41
       IDA : Inferred from Direct Assay
Assigned on 2004-12-15 SGD
mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         IDA : Inferred from Direct Assay
Assigned on 2004-09-28 SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           IDA : Inferred from Direct Assay
Assigned on 2006-12-12 SGD
plasma membrane Navarre C, et al. (2002) Subproteomics: identification of plasma membrane proteins from the yeast Saccharomyces cerevisiae. Proteomics 2(12):1706-14
         IDA : Inferred from Direct Assay
Assigned on 2006-09-06 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-1003
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSUR7/YML052W for SUR7
1) Sivadon P, et al. (1997) Cloning of the multicopy suppressor gene SUR7: evidence for a functional relationship between the yeast actin-binding protein Rvs167 and a putative membranous protein. Yeast 13(8):747-61

2) Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34

3) Walther TC, et al. (2006) Eisosomes mark static sites of endocytosis. Nature 439(7079):998-1003

4) Stradalova V, et al. (2009) Furrow-like invaginations of the yeast plasma membrane correspond to membrane compartment of Can1. J Cell Sci 122(Pt 16):2887-94

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SUR7/YML052W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SUR7/YML052W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MVKVWNI

C-term RPDDVSV

Length(aa) 302

MW(Da) 33,830

pI 7.46

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.111

Codon Adaptation Index 0.143

Frequency of Optimal Codons 0.466

Hydropathicity of Protein 0.187

Aromaticity Score 0.129

10 20 30 40 50 | | | | | MVKVWNIVLRLVVLLFLAGNTLLLILMIISGATDHYPVNRFYWVQGNTTG IPNAGDETRWTFWGACLQDKDGSDTCTSNLAPAYPISPVDNFNTHINVPH QFISKRDAFYYLTRFSFCFFWIALAFVGVSFILYVLTWCSKMLSEMVLIL MSFGFVFNTAAVVLQTAASAMAKNAFHDDHRSAQLGASMMGMAWASVFLC IVEFILLVFWSVRARLASTYSIDNSRYRTSSRWNPFHREKEQATDPILTA TGPEDMQQSASIVGPSSNANPVTATAATENQPKGINFFTIRKSHERPDDV SV*

Protein Structures from PDB: proteins of known structure with sequence similarity to SUR7/YML052W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SUR7 SGD (2007) Information without a citation in SGD

Standard Name	Reference
SUR7	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YML052W SGD Systematic Sequence

854953 NCBI: Gene ID

NP_013660.1 NCBI: RefSeq protein version ID

NP_013660.1 NCBI: RefSeq protein version ID

6323589 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YML052W	SGD Systematic Sequence
854953	NCBI: Gene ID
NP_013660.1	NCBI: RefSeq protein version ID
NP_013660.1	NCBI: RefSeq protein version ID
6323589	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
22 curated references; 0 references not yet curated
Reviews
Alvarez FJ, et al. (2009) The Sur7 protein resides in punctate membrane subdomains and mediates spatial regulation of cell wall synthesis in Candida albicans. Commun Integr Biol 2(2):76-7

Genetic Interactions
Kim JH, et al. (2009) The unfolded protein response is necessary but not sufficient to compensate for defects in disulfide isomerization. J Biol Chem 284(16):10400-8
         |ALG8 |APM3 |APS3 |ARL1 |AVL9 |CCZ1 |CDC50 |COG8 |EPS1 |ERV41 |ERV46 |EUG1 |FLD1 |GCS1 |MORE
Cellular Location
Strains/Constructs
Stradalova V, et al. (2009) Furrow-like invaginations of the yeast plasma membrane correspond to membrane compartment of Can1. J Cell Sci 122(Pt 16):2887-94
       |MAK3 |NCE102 |PIL1
RNA Levels and Processing
Woo DK, et al. (2009) Multiple pathways of mitochondrial-nuclear communication in yeast: Intergenomic signaling involves ABF1 and affects a different set of genes than retrograde regulation. Biochim Biophys Acta 1789(2):135-45
       |ABF1 |ACH1 |AGX1 |ALD3 |ARG4 |ARG7 |ARO4 |ATO2 |ATO3 |ATP14 |ATP16 |ATP17 |ATP19 |ATP2 |MORE
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Alvarez FJ, et al. (2008) The Sur7 protein regulates plasma membrane organization and prevents intracellular cell wall growth in Candida albicans. Mol Biol Cell 19(12):5214-25
       |FMP45 |LSP1 |PIL1 |PUN1 |YNL194C
Cellular Location
Strains/Constructs
Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88
       |CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |ERG6 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MORE
Cell Cycle Phase Involved
Mutants/Phenotypes
Regulation of
Strains/Constructs
Niu W, et al. (2008) Mechanisms of Cell Cycle Control Revealed by a Systematic and Quantitative Overexpression Screen in S. cerevisiae. PLoS Genet 4(7):e1000120
         |ACT1 |AIM20 |ALG6 |AME1 |ARC1 |ARF1 |ASK1 |ATG26 |AVO2 |BET4 |BUL1 |CBF1 |CDC31 |CDC39 |MORE
Cellular Location
Aronova S, et al. (2007) Probing the Membrane Environment of the TOR Kinases Reveals Functional Interactions between TORC1, Actin, and Membrane Trafficking in Saccharomyces cerevisiae. Mol Biol Cell 18(8):2779-94
     |AVO2 |BEM2 |BIT61 |CHS1 |CTR1 |DNF2 |ECM33 |ENA1 |ENA2 |ENA5 |FKS1 |FRE1 |GAS1 |GAS3 |MORE
Cellular Location
Strains/Constructs
Grossmann G, et al. (2007) Membrane potential governs lateral segregation of plasma membrane proteins and lipids in yeast. EMBO J 26(1):1-8
       |ATP1 |CAN1 |COX7 |FUR4 |HXT1 |PIL1 |PMA1 |TAT2
Cellular Location
Strains/Constructs
Perez-Valle J, et al. (2007) Key role for intracellular k+ and protein kinases sat4/hal4 and hal5 in the plasma membrane stabilization of yeast nutrient transporters. Mol Cell Biol 27(16):5725-36
       |CAN1 |FUR4 |HAL5 |HXT1 |PMA1 |RPS5 |SAT4 |TRK1 |TRK2
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Cellular Location
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Reviews
Toret CP and Drubin DG (2006) The budding yeast endocytic pathway. J Cell Sci 119(Pt 22):4585-7
       |ABP1 |BBC1 |BZZ1 |CAP1 |CAP2 |CHC1 |EDE1 |END3 |INP52 |LAS17 |LSP1 |MYO5 |PIL1 |PKH1 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Walther TC, et al. (2006) Eisosomes mark static sites of endocytosis. Nature 439(7079):998-1003
         |ABP1 |ACT1 |FMP45 |HXT2 |LSP1 |PAN1 |PIL1 |RVS161 |SLA2 |YNL194C
RNA Levels and Processing
Regulation of
Kleinschmidt M, et al. (2005) Transcriptional profiling of Saccharomyces cerevisiae cells under adhesion-inducing conditions. Mol Genet Genomics 273(5):382-93
           |AAD10 |APM3 |ARG1 |ARO10 |BAT2 |BIO3 |BRR2 |CPR6 |CUP1-1 |CUP1-2 |CWP2 |DDR48 |ECM22 |ERG12 |MORE
Cellular Location
Strains/Constructs
Malinska K, et al. (2004) Distribution of Can1p into stable domains reflects lateral protein segregation within the plasma membrane of living S. cerevisiae cells. J Cell Sci 117(Pt 25):6031-41
       |CAN1 |FUR4 |PMA1
Cellular Location
Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
DNA/RNA Sequence Features
Tamada Y, et al. (2003) Estimating gene networks from gene expression data by combining Bayesian network model with promoter element detection. Bioinformatics 19 Suppl 2:II227-II236
           |ACE2 |ALK1 |ARG2 |BUD4 |CHA4 |CLB2 |GAL11 |HOF1 |REB1 |SWI5 |SWI6
Reviews
Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14
     |ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |MORE
Cellular Location
Protein Sequence Features
Techniques and Reagents
Navarre C, et al. (2002) Subproteomics: identification of plasma membrane proteins from the yeast Saccharomyces cerevisiae. Proteomics 2(12):1706-14
         |FET4 |HXT7 |MRH1 |NCE102 |PDR5 |PMA1 |PTR2 |SNQ2 |YCK2 |YGR266W
Cellular Location
Function/Process
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Substrates/Ligands/Cofactors
Young ME, et al. (2002) The Sur7p family defines novel cortical domains in Saccharomyces cerevisiae, affects sphingolipid metabolism, and is involved in sporulation. Mol Cell Biol 22(3):927-34
       |FMP45 |RVS167 |YNL194C
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Sivadon P, et al. (1997) Cloning of the multicopy suppressor gene SUR7: evidence for a functional relationship between the yeast actin-binding protein Rvs167 and a putative membranous protein. Yeast 13(8):747-61
       |ACT1 |RVS161 |RVS167

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.